The hardware and bandwidth for this mirror is donated by METANET, the Webhosting and Full Service-Cloud Provider.
If you wish to report a bug, or if you are interested in having us mirror your free-software or open-source project, please feel free to contact us at mirror[@]metanet.ch.

Package {protti}


Title: Bottom-Up Proteomics and LiP-MS Quality Control and Data Analysis Tools
Version: 1.0.0
Description: Useful functions and workflows for proteomics quality control and data analysis of both limited proteolysis-coupled mass spectrometry (LiP-MS) (Feng et. al. (2014) <doi:10.1038/nbt.2999>) and regular bottom-up proteomics experiments. Data generated with search tools such as 'Spectronaut', 'MaxQuant' and 'Proteome Discover' can be easily used due to flexibility of functions.
License: MIT + file LICENSE
Encoding: UTF-8
LazyData: true
Imports: rlang, dplyr, stringr, magrittr, data.table, janitor, progress, purrr, tidyr, ggplot2, forcats, tibble, plotly, ggrepel, utils, grDevices, curl, readr, lifecycle, httr, methods, R.utils, stats
RoxygenNote: 7.3.3
Suggests: testthat, covr, knitr, rmarkdown, shiny, r3dmol, proDA, limma, dendextend, pheatmap, heatmaply, furrr, future, parallel, seriation, drc, igraph, stringi, STRINGdb, iq, scales, farver, ggforce, xml2, jsonlite, missForest
Depends: R (≥ 4.0)
URL: https://github.com/jpquast/protti, https://jpquast.github.io/protti/
BugReports: https://github.com/jpquast/protti/issues
VignetteBuilder: knitr
NeedsCompilation: no
Packaged: 2026-01-14 00:28:05 UTC; jan-philippquast
Author: Jan-Philipp Quast ORCID iD [aut, cre], Dina Schuster ORCID iD [aut], ETH Zurich [cph, fnd]
Maintainer: Jan-Philipp Quast <jpquast.software@gmail.com>
Repository: CRAN
Date/Publication: 2026-01-14 07:50:01 UTC

Analyse protein interaction network for significant hits

Description

The STRING database provides a resource for known and predicted protein-protein interactions. The type of interactions include direct (physical) and indirect (functional) interactions. Through the R package STRINGdb this resource if provided to R users. This function provides a convenient wrapper for STRINGdb functions that allow an easy use within the protti pipeline.

Usage

analyse_functional_network(
  data,
  protein_id,
  string_id,
  organism_id,
  version = "12.0",
  score_threshold = 900,
  binds_treatment = NULL,
  halo_color = NULL,
  plot = TRUE
)

Arguments

data

a data frame that contains significantly changing proteins (STRINGdb is only able to plot 400 proteins at a time so do not provide more for network plots). Information about treatment binding can be provided and will be displayed as colorful halos around the proteins in the network.

protein_id

a character column in the data data frame that contains the protein accession numbers.

string_id

a character column in the data data frame that contains STRING database identifiers. These can be obtained from UniProt.

organism_id

a numeric value specifying an organism ID (NCBI taxon-ID). This can be obtained from here. H. sapiens: 9606, S. cerevisiae: 4932, E. coli: 511145.

version

a character value that specifies the version of STRINGdb to be used. Default is 12.0.

score_threshold

a numeric value specifying the interaction score that based on STRING has to be between 0 and 1000. A score closer to 1000 is related to a higher confidence for the interaction. The default value is 900.

binds_treatment

a logical column in the data data frame that indicates if the corresponding protein binds to the treatment. This information can be obtained from different databases, e.g UniProt.

halo_color

optional, character value with a color hex-code. This is the color of the halo of proteins that bind the treatment.

plot

a logical that indicates whether the result should be plotted or returned as a table.

Value

A network plot displaying interactions of the provided proteins. If binds_treatment was provided halos around the proteins show which proteins interact with the treatment. If plot = FALSE a data frame with interaction information is returned.

Examples


# Create example data
data <- data.frame(
  uniprot_id = c(
    "P0A7R1",
    "P02359",
    "P60624",
    "P0A7M2",
    "P0A7X3",
    "P0AGD3"
  ),
  xref_string = c(
    "511145.b4203;",
    "511145.b3341;",
    "511145.b3309;",
    "511145.b3637;",
    "511145.b3230;",
    "511145.b1656;"
  ),
  is_known = c(
    TRUE,
    TRUE,
    TRUE,
    TRUE,
    TRUE,
    FALSE
  )
)

# Perform network analysis
network <- analyse_functional_network(
  data,
  protein_id = uniprot_id,
  string_id = xref_string,
  organism_id = 511145,
  binds_treatment = is_known,
  plot = TRUE
)

network


Perform ANOVA

Description

Performs an ANOVA statistical test

Usage

anova_protti(data, grouping, condition, mean_ratio, sd, n)

Arguments

data

a data frame containing at least the input variables.

grouping

a character column in the data data frame that contains precursor or peptide identifiers.

condition

a character or numeric column in the data data frame that contains the conditions.

mean_ratio

a numeric column in the data data frame that contains mean intensities or mean intensity ratios.

sd

a numeric column in the data data frame that contains the standard deviation corresponding to the mean.

n

a numeric column in the data data frame that contains the number of replicates for which the corresponding mean was calculated.

Value

a data frame that contains the within group error (ms_group) and the between group error (ms_error), f statistic and p-values.

Examples

data <- data.frame(
  precursor = c("A", "A", "A", "B", "B", "B"),
  condition = c("C1", "C2", "C3", "C1", "C2", "C3"),
  mean = c(10, 12, 20, 11, 12, 8),
  sd = c(2, 1, 1.5, 1, 2, 4),
  n = c(4, 4, 4, 4, 4, 4)
)

anova_protti(
  data,
  grouping = precursor,
  condition = condition,
  mean = mean,
  sd = sd,
  n = n
)

Assignment of missingness types

Description

The type of missingness (missing at random, missing not at random) is assigned based on the comparison of a reference condition and every other condition.

Usage

assign_missingness(
  data,
  sample,
  condition,
  grouping,
  intensity,
  ref_condition = "all",
  completeness_MAR = 0.7,
  completeness_MNAR = 0.2,
  retain_columns = NULL
)

Arguments

data

a data frame containing at least the input variables.

sample

a character column in the data data frame that contains the sample name.

condition

a character or numeric column in the data data frame that contains the conditions.

grouping

a character column in the data data frame that contains protein, precursor or peptide identifiers.

intensity

a numeric column in the data data frame that contains intensity values that relate to the grouping variable.

ref_condition

a character vector providing the condition that is used as a reference for missingness determination. Instead of providing one reference condition, "all" can be supplied, which will create all pairwise condition pairs. By default ref_condition = "all".

completeness_MAR

a numeric value that specifies the minimal degree of data completeness to be considered as MAR. Value has to be between 0 and 1, default is 0.7. It is multiplied with the number of replicates and then adjusted downward. The resulting number is the minimal number of observations for each condition to be considered as MAR. This number is always at least 1.

completeness_MNAR

a numeric value that specifies the maximal degree of data completeness to be considered as MNAR. Value has to be between 0 and 1, default is 0.20. It is multiplied with the number of replicates and then adjusted downward. The resulting number is the maximal number of observations for one condition to be considered as MNAR when the other condition is complete.

retain_columns

a vector that indicates columns that should be retained from the input data frame. Default is not retaining additional columns retain_columns = NULL. Specific columns can be retained by providing their names (not in quotations marks, just like other column names, but in a vector).

Value

A data frame that contains the reference condition paired with each treatment condition. The comparison column contains the comparison name for the specific treatment/reference pair. The missingness column reports the type of missingness.

The type of missingness has an influence on the way values are imputeted if imputation is performed subsequently using the impute() function. How each type of missingness is specifically imputed can be found in the function description. The type of missingness assigned to a comparison does not have any influence on the statistical test in the calculate_diff_abundance() function.

Examples

set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 10,
  frac_change = 0.5,
  n_replicates = 4,
  n_conditions = 2,
  method = "effect_random",
  additional_metadata = FALSE
)

head(data, n = 24)

# Assign missingness information
data_missing <- assign_missingness(
  data,
  sample = sample,
  condition = condition,
  grouping = peptide,
  intensity = peptide_intensity_missing,
  ref_condition = "all",
  retain_columns = c(protein)
)

head(data_missing, n = 24)

Assign peptide type

Description

Based on preceding and C-terminal amino acid, the peptide type of a given peptide is assigned. Peptides with preceeding and C-terminal lysine or arginine are considered fully-tryptic. If a peptide is located at the N- or C-terminus of a protein and fulfills the criterium to be fully-tryptic otherwise, it is also considered as fully-tryptic. Peptides that only fulfill the criterium on one terminus are semi-tryptic peptides. Lastly, peptides that are not fulfilling the criteria for both termini are non-tryptic peptides. In addition, peptides that miss the initial Methionine of a protein are considered "tryptic" at that site if there is no other peptide starting at position 1 for that protein.

Usage

assign_peptide_type(
  data,
  aa_before = aa_before,
  last_aa = last_aa,
  aa_after = aa_after,
  protein_id = NULL,
  start = start
)

Arguments

data

a data frame containing at least information about the preceding and C-terminal amino acids of peptides.

aa_before

a character column in the data data frame that contains the preceding amino acid as one letter code.

last_aa

a character column in the data data frame that contains the C-terminal amino acid as one letter code.

aa_after

a character column in the data data frame that contains the following amino acid as one letter code.

protein_id

a character column in the data data frame that contains the protein accession numbers.

start

a numeric column in the data data frame that contains the start position of each peptide within the corresponding protein. This is used to check if the protein is consistently missing the initial Methionine, making peptides starting at position 2 "tryptic" on that site.

Value

A data frame that contains the input data and an additional column with the peptide type information.

Examples

data <- data.frame(
  aa_before = c("K", "M", "", "M", "S", "M", "-"),
  last_aa = c("R", "K", "R", "R", "Y", "K", "K"),
  aa_after = c("T", "R", "T", "R", "T", "R", "T"),
  protein_id = c("P1", "P1", "P3", "P3", "P2", "P2", "P2"),
  start = c(38, 2, 1, 2, 10, 2, 1)
)

assign_peptide_type(data, aa_before, last_aa, aa_after, protein_id, start)

Barcode plot

Description

Plots a "barcode plot" - a vertical line for each identified peptide. Peptides can be colored based on an additional variable. Also differential abundance can be displayed.

Usage

barcode_plot(
  data,
  start_position,
  end_position,
  protein_length,
  coverage = NULL,
  colouring = NULL,
  fill_colour_gradient = protti::mako_colours,
  fill_colour_discrete = c("#999999", protti::protti_colours),
  protein_id = NULL,
  facet = NULL,
  facet_n_col = 4,
  cutoffs = NULL
)

Arguments

data

a data frame containing differential abundance, start and end peptide or precursor positions and protein length.

start_position

a numeric column in the data frame containing the start positions for each peptide or precursor.

end_position

a numeric column in the data frame containing the end positions for each peptide or precursor.

protein_length

a numeric column in the data frame containing the length of the protein.

coverage

optional, numeric column in the data frame containing coverage in percent. Will appear in the title of the barcode if provided.

colouring

optional, column in the data frame containing information by which peptide or precursors should be colored.

fill_colour_gradient

a vector that contains colours that should be used to create a colour gradient for the barcode plot bars if the colouring argument is continuous. Default is mako_colours.

fill_colour_discrete

a vector that contains colours that should be used to fill the barcode plot bars if the colouring argument is discrete. Default is protti_colours.

protein_id

optional, column in the data frame containing protein identifiers. Required if only one protein should be plotted and the data frame contains only information for this protein.

facet

optional, column in the data frame containing information by which data should be faceted. This can be protein identifiers. Only 20 proteins are plotted at a time, the rest is ignored. If more should be plotted, a mapper over a subsetted data frame should be created.

facet_n_col

a numeric value that specifies the number of columns the faceted plot should have if a column name is provided to group. The default is 4.

cutoffs

optional argument specifying the log2 fold change and significance cutoffs used for highlighting peptides. If this argument is provided colouring information will be overwritten with peptides that fulfill this condition. The cutoff should be provided in a vector of the form c(diff = 2, pval = 0.05). The name of the cutoff should reflect the column name that contains this information (log2 fold changes, p-values or adjusted p-values).

Value

A barcode plot is returned.

Examples


data <- data.frame(
  start = c(5, 40, 55, 130, 181, 195),
  end = c(11, 51, 60, 145, 187, 200),
  length = rep(200, 6),
  pg_protein_accessions = rep("Protein 1", 6),
  diff = c(1, 2, 5, 2, 1, 1),
  pval = c(0.1, 0.01, 0.01, 0.2, 0.2, 0.01)
)

barcode_plot(
  data,
  start_position = start,
  end_position = end,
  protein_length = length,
  facet = pg_protein_accessions,
  cutoffs = c(diff = 2, pval = 0.05)
)

Calculate scores for each amino acid position in a protein sequence

Description

[Experimental] Calculate a score for each amino acid position in a protein sequence based on the product of the -log10(adjusted p-value) and the absolute log2(fold change) per peptide covering this amino acid. In detail, all the peptides are aligned along the sequence of the corresponding protein, and the average score per amino acid position is computed. In a limited proteolysis coupled to mass spectrometry (LiP-MS) experiment, the score allows to prioritize and narrow down structurally affected regions.

Usage

calculate_aa_scores(
  data,
  protein,
  diff = diff,
  adj_pval = adj_pval,
  start_position,
  end_position,
  retain_columns = NULL
)

Arguments

data

a data frame containing at least the input columns.

protein

a character column in the data frame containing the protein identifier or name.

diff

a numeric column in the data data frame containing the log2 fold change.

adj_pval

a numeric column in the data data frame containing the adjusted p-value.

start_position

a numeric column data in the data frame containing the start position of a peptide or precursor.

end_position

a numeric column in the data frame containing the end position of a peptide or precursor.

retain_columns

a vector indicating if certain columns should be retained from the input data frame. Default is not retaining additional columns retain_columns = NULL. Specific columns can be retained by providing their names (not in quotations marks, just like other column names, but in a vector).

Value

A data frame that contains the aggregated scores per amino acid position, enabling to draw fingerprints for each individual protein.

Author(s)

Patrick Stalder

Examples


data <- data.frame(
  pg_protein_accessions = c(rep("protein_1", 10)),
  diff = c(2, -3, 1, 2, 3, -3, 5, 1, -0.5, 2),
  adj_pval = c(0.001, 0.01, 0.2, 0.05, 0.002, 0.5, 0.4, 0.7, 0.001, 0.02),
  start = c(1, 3, 5, 10, 15, 25, 28, 30, 41, 51),
  end = c(6, 8, 10, 16, 23, 35, 35, 35, 48, 55)
)
calculate_aa_scores(
  data,
  protein = pg_protein_accessions,
  diff = diff,
  adj_pval = adj_pval,
  start_position = start,
  end_position = end
)

Calculate differential abundance between conditions

Description

Performs differential abundance calculations and statistical hypothesis tests on data frames with protein, peptide or precursor data. Different methods for statistical testing are available.

Usage

calculate_diff_abundance(
  data,
  sample,
  condition,
  grouping,
  intensity_log2,
  missingness = missingness,
  comparison = comparison,
  mean = NULL,
  sd = NULL,
  n_samples = NULL,
  ref_condition = "all",
  filter_NA_missingness = TRUE,
  method = c("moderated_t-test", "t-test", "t-test_mean_sd", "proDA"),
  p_adj_method = "BH",
  limma_legacy_estimation = NULL,
  retain_columns = NULL
)

Arguments

data

a data frame containing at least the input variables that are required for the selected method. Ideally the output of assign_missingness or impute is used.

sample

a character column in the data data frame that contains the sample name. Is not required if method = "t-test_mean_sd".

condition

a character or numeric column in the data data frame that contains the conditions.

grouping

a character column in the data data frame that contains precursor, peptide or protein identifiers.

intensity_log2

a numeric column in the data data frame that contains intensity values. The intensity values need to be log2 transformed. Is not required if method = "t-test_mean_sd".

missingness

a character column in the data data frame that contains missingness information. Can be obtained by calling assign_missingness(). Is not required if method = "t-test_mean_sd". The type of missingness assigned to a comparison does not have any influence on the statistical test. However, if filter_NA_missingness = TRUE and method = "proDA", then comparisons with missingness NA are filtered out prior to p-value adjustment.

comparison

a character column in the data data frame that contains information of treatment/reference condition pairs. Can be obtained by calling assign_missingness. Comparisons need to be in the form condition1_vs_condition2, meaning two compared conditions are separated by "_vs_". This column determines for which condition pairs differential abundances are calculated. Is not required if method = "t-test_mean_sd", in that case please provide a reference condition with the ref_condition argument.

mean

a numeric column in the data data frame that contains mean values for two conditions. Is only required if method = "t-test_mean_sd".

sd

a numeric column in the data data frame that contains standard deviations for two conditions. Is only required if method = "t-test_mean_sd".

n_samples

a numeric column in the data data frame that contains the number of samples per condition for two conditions. Is only required if method = "t-test_mean_sd".

ref_condition

optional, character value providing the condition that is used as a reference for differential abundance calculation. Only required for method = "t-test_mean_sd". Instead of providing one reference condition, "all" can be supplied, which will create all pairwise condition pairs. By default ref_condition = "all".

filter_NA_missingness

a logical value, default is TRUE. For all methods except "t-test_mean_sd" missingness information has to be provided. This information can be for example obtained by calling assign_missingness(). If a reference/treatment pair has too few samples to be considered robust based on user defined cutoffs, it is annotated with NA as missingness by the assign_missingness() function. If this argument is TRUE, these NA reference/treatment pairs are filtered out. For method = "proDA" this is done before the p-value adjustment.

method

a character value, specifies the method used for statistical hypothesis testing. Methods include Welch test ("t-test"), a Welch test on means, standard deviations and number of replicates ("t-test_mean_sd") and a moderated t-test based on the limma package ("moderated_t-test"). More information on the moderated t-test can be found in the limma documentation. Furthermore, the proDA package specific method ("proDA") can be used to infer means across samples based on a probabilistic dropout model. This eliminates the need for data imputation since missing values are inferred from the model. More information can be found in the proDA documentation. We do not recommend using the moderated_t-test or proDA method if the data was filtered for low CVs or imputation was performed. Default is method = "moderated_t-test".

p_adj_method

a character value, specifies the p-value correction method. Possible methods are c("holm", "hochberg", "hommel", "bonferroni", "BH", "BY", "fdr", "none"). Default method is "BH".

limma_legacy_estimation

a logical value, specifying if the new or old hyperparameter estimation of the limma package should be used. See the legacy argument of ?limma:eBayes for more information. Our default is the same as for the limma package, which introduces a changed and more robust estimation of hyperparameters. This may cause changes to the results when compared to before August 2024 (limma 3.61.8).

retain_columns

a vector indicating if certain columns should be retained from the input data frame. Default is not retaining additional columns retain_columns = NULL. Specific columns can be retained by providing their names (not in quotations marks, just like other column names, but in a vector). Please note that if you retain columns that have multiple rows per grouped variable there will be duplicated rows in the output.

Value

A data frame that contains differential abundances (diff), p-values (pval) and adjusted p-values (adj_pval) for each protein, peptide or precursor (depending on the grouping variable) and the associated treatment/reference pair. Depending on the method the data frame contains additional columns:

For all methods execept "proDA", the p-value adjustment is performed only on the proportion of data that contains a p-value that is not NA. For "proDA" the p-value adjustment is either performed on the complete dataset (filter_NA_missingness = TRUE) or on the subset of the dataset with missingness that is not NA (filter_NA_missingness = FALSE).

Examples

set.seed(123) # Makes example reproducible

# Create synthetic data
data <- create_synthetic_data(
  n_proteins = 10,
  frac_change = 0.5,
  n_replicates = 4,
  n_conditions = 2,
  method = "effect_random",
  additional_metadata = FALSE
)

# Assign missingness information
data_missing <- assign_missingness(
  data,
  sample = sample,
  condition = condition,
  grouping = peptide,
  intensity = peptide_intensity_missing,
  ref_condition = "all",
  retain_columns = c(protein, change_peptide)
)

# Calculate differential abundances
# Using "moderated_t-test" and "proDA" improves
# true positive recovery progressively
diff <- calculate_diff_abundance(
  data = data_missing,
  sample = sample,
  condition = condition,
  grouping = peptide,
  intensity_log2 = peptide_intensity_missing,
  missingness = missingness,
  comparison = comparison,
  method = "t-test",
  retain_columns = c(protein, change_peptide)
)

head(diff, n = 10)

Perform gene ontology enrichment analysis

Description

Analyses enrichment of gene ontology terms associated with proteins in the fraction of significant proteins compared to all detected proteins. A two-sided Fisher's exact test is performed to test significance of enrichment or depletion. GO annotations can be provided to this function either through UniProt go_annotations_uniprot, through a table obtained with fetch_go in the go_data argument or GO annotations are fetched automatically by the function by providing ontology_type and organism_id.

Usage

calculate_go_enrichment(
  data,
  protein_id,
  is_significant,
  group = NULL,
  y_axis_free = TRUE,
  facet_n_col = 2,
  go_annotations_uniprot = NULL,
  ontology_type,
  organism_id = NULL,
  go_data = NULL,
  plot = TRUE,
  plot_style = "barplot",
  plot_title = "Gene ontology enrichment of significant proteins",
  barplot_fill_colour = c("#56B4E9", "#E76145"),
  heatmap_fill_colour = protti::mako_colours,
  heatmap_fill_colour_rev = TRUE,
  label = TRUE,
  label_size = 7,
  enrichment_type = "all",
  replace_long_name = TRUE,
  label_move_frac = 0.2,
  min_n_detected_proteins_in_process = 1,
  plot_cutoff = "adj_pval top10"
)

Arguments

data

a data frame that contains at least the input variables.

protein_id

a character column in the data data frame that contains the protein accession numbers.

is_significant

a logical column in the data data frame that indicates if the corresponding protein has a significantly changing peptide. The input data frame may contain peptide level information with significance information. The function is able to extract protein level information from this.

group

optional, character column in the data data frame that contains information by which the analysis should be grouped. The analysis will be performed separately for each of the groups. This is most likely a column that labels separate comparisons of different conditions. In protti the assign_missingness() function creates such a column automatically.

y_axis_free

a logical value that specifies if the y-axis of the plot should be "free" for each facet if a grouping variable is provided. Default is TRUE. If FALSE is selected it is easier to compare GO categories directly with each other.

facet_n_col

a numeric value that specifies the number of columns the faceted plot should have if a column name is provided to group. The default is 2.

go_annotations_uniprot

recommended, a character column in the data data frame that contains gene ontology annotations obtained from UniProt using fetch_uniprot. These annotations are already separated into the desired ontology type so the argument ontology_type is not required.

ontology_type

optional, character value specifying the type of ontology that should be used. Possible values are molecular function (MF), biological process (BP), cellular component (CC). This argument is not required if GO annotations are provided from UniProt in go_annotations_uniprot. It is required if annotations are provided through go_data or automatically fetched.

organism_id

optional, character value specifying an NCBI taxonomy identifier of an organism (TaxId). Possible inputs include only: "9606" (Human), "559292" (Yeast) and "83333" (E. coli). Is only necessary if GO data is not provided either by go_annotations_uniprot or in go_data.

go_data

Optional, a data frame that can be obtained with fetch_go(). If you provide data not obtained with fetch_go() make sure column names for protein ID (db_id) and GO ID (go_id) are the same as for data obtained with fetch_go().

plot

a logical argument indicating whether the result should be plotted or returned as a table.

plot_style

a character argument that specifies the plot style. Can be either "barplot" (default) or "heatmap". The "heatmap" plot is especially useful for the comparison of multiple groups. We recommend, however, that you use it only with enrichment_type = "enriched" or ⁠enrichment_type = "deenriched⁠, because otherwise it is not possible to distinguish between enrichment and deenrichment in the plot.

plot_title

a character value that specifies the title of the plot. The default is "Gene ontology enrichment of significant proteins".

barplot_fill_colour

a vector that contains two colours that should be used as the fill colours for deenriched and enriched GO terms, respectively. If enrichment_type = "enriched" or ⁠"deenriched⁠, please still provide two values in the vector, the colour not used for the plot can be NA in this case. E.g. c(NA, "red") for enrichment_type = "enriched".

heatmap_fill_colour

a vector that contains colours that should be used to create the gradient in the heatmap plot. Default is mako_colours.

heatmap_fill_colour_rev

a logical value that specifies if the provided colours in heatmap_fill_colour should be reversed in order. Default is TRUE.

label

a logical argument indicating whether labels should be added to the plot. Default is TRUE.

label_size

a numeric argument that specifies the text size of the labels with the unit "pt". The default is 7.

enrichment_type

a character argument that is either "all", "enriched" or "deenriched". This determines if the enrichment analysis should be performed in order to check for both enrichemnt and deenrichemnt or only one of the two. This affects the statistics performed and therefore also the displayed plot.

replace_long_name

a logical argument that specifies if GO term names above 50 characters should be replaced by the GO ID instead for the plot. This ensures that the plotting area doesn't become too small due to the long name. The default is TRUE.

label_move_frac

a numeric argument between 0 and 1 that specifies which labels should be moved outside of the bar. The default is 0.2, which means that the labels of all bars that have a size of 20% or less of the largest bar are moved to the right of the bar. This prevents labels from overlapping with the bar boundaries.

min_n_detected_proteins_in_process

is a numeric argument that specifies the minimum number of detected proteins required for a GO term to be displayed in the plot. The default is 1, meaning no filtering of the plotted data is performed. This argument does not affect any computations or the returned data if plot = FALSE. This argument is useful in order to remove terms that were only detected in for example 1 protein. Even though these terms are sometimes significant, they are not really relevant.

plot_cutoff

a character value indicating if the plot should contain the top n (e.g. top10) most significant proteins (p-value or adjusted p-value), or if a significance cutoff should be used to determine the number of GO terms in the plot. This information should be provided with the type first followed by the threshold separated by a space. Example are plot_cutoff = "adj_pval top10", plot_cutoff = "pval 0.05" or plot_cutoff = "adj_pval 0.01". The threshold can be chosen freely. The default value is "adj_pval top10".

Value

A bar plot or heatmap (depending on plot_style). By default the bar plot displays negative log10 adjusted p-values for the top 10 enriched or deenriched gene ontology terms. Alternatively, plot cutoffs can be chosen individually with the plot_cutoff argument. Bars are colored according to the direction of the enrichment (enriched or deenriched). If a heatmap is returned, terms are organised on the y-axis, while the colour of each tile represents the negative log10 adjusted p-value (default). If a group column is provided the x-axis contains all groups. If plot = FALSE, a data frame is returned. P-values are adjusted with Benjamini-Hochberg.

Examples


# Load libraries
library(dplyr)
library(stringr)

# Create example data
# Contains artificial de-enrichment for ribosomes.
uniprot_go_data <- fetch_uniprot_proteome(
  organism_id = 83333,
  columns = c(
    "accession",
    "go_f"
  )
)

if (!is(uniprot_go_data, "character")) {
  data <- uniprot_go_data %>%
    mutate(significant = c(
      rep(TRUE, 1000),
      rep(FALSE, n() - 1000)
    )) %>%
    mutate(significant = ifelse(
      str_detect(
        go_f,
        pattern = "ribosome"
      ),
      FALSE,
      significant
    )) %>%
    mutate(group = c(
      rep("A", 500),
      rep("B", 500),
      rep("A", (n() - 1000) / 2),
      rep("B", round((n() - 1000) / 2))
    ))

  # Plot gene ontology enrichment
  calculate_go_enrichment(
    data,
    protein_id = accession,
    go_annotations_uniprot = go_f,
    is_significant = significant,
    plot = TRUE,
    plot_cutoff = "pval 0.01"
  )

  # Plot gene ontology enrichment with group
  calculate_go_enrichment(
    data,
    protein_id = accession,
    go_annotations_uniprot = go_f,
    is_significant = significant,
    group = group,
    facet_n_col = 1,
    plot = TRUE,
    plot_cutoff = "pval 0.01"
  )

  # Plot gene ontology enrichment with group in a heatmap plot
  calculate_go_enrichment(
    data,
    protein_id = accession,
    group = group,
    go_annotations_uniprot = go_f,
    is_significant = significant,
    min_n_detected_proteins_in_process = 15,
    plot = TRUE,
    label = TRUE,
    plot_style = "heatmap",
    enrichment_type = "enriched",
    plot_cutoff = "pval 0.01"
  )

  # Calculate gene ontology enrichment
  go_enrichment <- calculate_go_enrichment(
    data,
    protein_id = accession,
    go_annotations_uniprot = go_f,
    is_significant = significant,
    plot = FALSE,
  )

  head(go_enrichment, n = 10)
}


Sampling of values for imputation

Description

calculate_imputation is a helper function that is used in the impute function. Depending on the type of missingness and method, it samples values from a normal distribution that can be used for the imputation. Note: The input intensities should be log2 transformed.

Usage

calculate_imputation(
  min = NULL,
  noise = NULL,
  mean = NULL,
  sd,
  missingness = c("MNAR", "MAR"),
  method = c("ludovic", "noise"),
  skip_log2_transform_error = FALSE
)

Arguments

min

a numeric value specifying the minimal intensity value of the precursor/peptide. Is only required if method = "ludovic" and missingness = "MNAR".

noise

a numeric value specifying a noise value for the precursor/peptide. Is only required if method = "noise" and missingness = "MNAR".

mean

a numeric value specifying the mean intensity value of the condition with missing values for a given precursor/peptide. Is only required if missingness = "MAR".

sd

a numeric value specifying the mean of the standard deviation of all conditions for a given precursor/peptide.

missingness

a character value specifying the missingness type of the data determines how values for imputation are sampled. This can be "MAR" or "MNAR".

method

a character value specifying the method to be used for imputation. For method = "ludovic", MNAR missingness is sampled around a value that is three lower (log2) than the lowest intensity value recorded for the precursor/peptide. For method = "noise", MNAR missingness is sampled around the noise value for the precursor/peptide.

skip_log2_transform_error

a logical value, if FALSE a check is performed to validate that input values are log2 transformed. If input values are > 40 the test is failed and an error is returned.

Value

A value sampled from a normal distribution with the input parameters. Method specifics are applied to input parameters prior to sampling.


Perform KEGG pathway enrichment analysis

Description

Analyses enrichment of KEGG pathways associated with proteins in the fraction of significant proteins compared to all detected proteins. A Fisher's exact test is performed to test significance of enrichment.

Usage

calculate_kegg_enrichment(
  data,
  protein_id,
  is_significant,
  pathway_id = pathway_id,
  pathway_name = pathway_name,
  plot = TRUE,
  plot_cutoff = "adj_pval top10"
)

Arguments

data

a data frame that contains at least the input variables.

protein_id

a character column in the data data frame that contains the protein accession numbers.

is_significant

a logical column in the data data frame that indicates if the corresponding protein has a significantly changing peptide. The input data frame may contain peptide level information with significance information. The function is able to extract protein level information from this.

pathway_id

a character column in the data data frame that contains KEGG pathway identifiers. These can be obtained from KEGG using fetch_kegg.

pathway_name

a character column in the data data frame that contains KEGG pathway names. These can be obtained from KEGG using fetch_kegg.

plot

a logical value indicating whether the result should be plotted or returned as a table.

plot_cutoff

a character value indicating if the plot should contain the top 10 most significant proteins (p-value or adjusted p-value), or if a significance cutoff should be used to determine the number of GO terms in the plot. This information should be provided with the type first followed by the threshold separated by a space. Example are plot_cutoff = "adj_pval top10", plot_cutoff = "pval 0.05" or plot_cutoff = "adj_pval 0.01". The threshold can be chosen freely.

Value

A bar plot displaying negative log10 adjusted p-values for the top 10 enriched pathways. Bars are coloured according to the direction of the enrichment. If plot = FALSE, a data frame is returned.

Examples


# Load libraries
library(dplyr)

set.seed(123) # Makes example reproducible

# Create example data
kegg_data <- fetch_kegg(species = "eco")

if (!is.null(kegg_data)) { # only proceed if information was retrieved
  data <- kegg_data %>%
    group_by(uniprot_id) %>%
    mutate(significant = rep(
      sample(
        x = c(TRUE, FALSE),
        size = 1,
        replace = TRUE,
        prob = c(0.2, 0.8)
      ),
      n = n()
    ))

  # Plot KEGG enrichment
  calculate_kegg_enrichment(
    data,
    protein_id = uniprot_id,
    is_significant = significant,
    pathway_id = pathway_id,
    pathway_name = pathway_name,
    plot = TRUE,
    plot_cutoff = "pval 0.05"
  )

  # Calculate KEGG enrichment
  kegg <- calculate_kegg_enrichment(
    data,
    protein_id = uniprot_id,
    is_significant = significant,
    pathway_id = pathway_id,
    pathway_name = pathway_name,
    plot = FALSE
  )

  head(kegg, n = 10)
}


Label-free protein quantification

Description

Determines relative protein abundances from ion quantification. Only proteins with at least three peptides are considered for quantification. The three peptide rule applies for each sample independently.

Usage

calculate_protein_abundance(
  data,
  sample,
  protein_id,
  precursor,
  peptide,
  intensity_log2,
  min_n_peptides = 3,
  method = "sum",
  for_plot = FALSE,
  retain_columns = NULL
)

Arguments

data

a data frame that contains at least the input variables.

sample

a character column in the data data frame that contains the sample name.

protein_id

a character column in the data data frame that contains the protein accession numbers.

precursor

a character column in the data data frame that contains precursors.

peptide

a character column in the data data frame that contains peptide sequences. This column is needed to filter for proteins with at least 3 unique peptides. This can equate to more than three precursors. The quantification is done on the precursor level.

intensity_log2

a numeric column in the data data frame that contains log2 transformed precursor intensities.

min_n_peptides

An integer specifying the minimum number of peptides required for a protein to be included in the analysis. The default value is 3, which means proteins with fewer than three unique peptides will be excluded from the analysis.

method

a character value specifying with which method protein quantities should be calculated. Possible options include "sum", which takes the sum of all precursor intensities as the protein abundance. Another option is "iq", which performs protein quantification based on a maximal peptide ratio extraction algorithm that is adapted from the MaxLFQ algorithm of the MaxQuant software. Functions from the iq package (doi:10.1093/bioinformatics/btz961) are used. Default is "iq".

for_plot

a logical value indicating whether the result should be only protein intensities or protein intensities together with precursor intensities that can be used for plotting using peptide_profile_plot(). Default is FALSE.

retain_columns

a vector indicating if certain columns should be retained from the input data frame. Default is not retaining additional columns retain_columns = NULL. Specific columns can be retained by providing their names (not in quotations marks, just like other column names, but in a vector).

Value

If for_plot = FALSE, protein abundances are returned, if for_plot = TRUE also precursor intensities are returned in a data frame. The later output is ideal for plotting with peptide_profile_plot() and can be filtered to only include protein abundances.

Examples


# Create example data
data <- data.frame(
  sample = c(
    rep("S1", 6),
    rep("S2", 6),
    rep("S1", 2),
    rep("S2", 2)
  ),
  protein_id = c(
    rep("P1", 12),
    rep("P2", 4)
  ),
  precursor = c(
    rep(c("A1", "A2", "B1", "B2", "C1", "D1"), 2),
    rep(c("E1", "F1"), 2)
  ),
  peptide = c(
    rep(c("A", "A", "B", "B", "C", "D"), 2),
    rep(c("E", "F"), 2)
  ),
  intensity = c(
    rnorm(n = 6, mean = 15, sd = 2),
    rnorm(n = 6, mean = 21, sd = 1),
    rnorm(n = 2, mean = 15, sd = 1),
    rnorm(n = 2, mean = 15, sd = 2)
  )
)

data

# Calculate protein abundances
protein_abundance <- calculate_protein_abundance(
  data,
  sample = sample,
  protein_id = protein_id,
  precursor = precursor,
  peptide = peptide,
  intensity_log2 = intensity,
  method = "sum",
  for_plot = FALSE
)

protein_abundance

# Calculate protein abundances and retain precursor
# abundances that can be used in a peptide profile plot
complete_abundances <- calculate_protein_abundance(
  data,
  sample = sample,
  protein_id = protein_id,
  precursor = precursor,
  peptide = peptide,
  intensity_log2 = intensity,
  method = "sum",
  for_plot = TRUE
)

complete_abundances


Protein sequence coverage

Description

Calculate sequence coverage for each identified protein.

Usage

calculate_sequence_coverage(data, protein_sequence, peptides)

Arguments

data

a data frame containing at least the protein sequence and the identified peptides as columns.

protein_sequence

a character column in the data data frame that contains protein sequences. Can be obtained by using the function fetch_uniprot()

peptides

a character column in the data data frame that contains the identified peptides.

Value

A new column in the data data frame containing the calculated sequence coverage for each identified protein

Examples

data <- data.frame(
  protein_sequence = c("abcdefghijklmnop", "abcdefghijklmnop"),
  pep_stripped_sequence = c("abc", "jklmn")
)

calculate_sequence_coverage(
  data,
  protein_sequence = protein_sequence,
  peptides = pep_stripped_sequence
)

Check treatment enrichment

Description

Check for an enrichment of proteins interacting with the treatment in significantly changing proteins as compared to all proteins.

Usage

calculate_treatment_enrichment(
  data,
  protein_id,
  is_significant,
  binds_treatment,
  group = NULL,
  treatment_name,
  plot = TRUE,
  fill_colours = protti::protti_colours,
  fill_by_group = FALSE,
  facet_n_col = 2
)

Arguments

data

a data frame contains at least the input variables.

protein_id

a character column in the data data frame that contains the protein accession numbers.

is_significant

a logical column in the data data frame that indicates if the corresponding protein has a significantly changing peptide. The input data frame may contain peptide level information with significance information. The function is able to extract protein level information from this.

binds_treatment

a logical column in the data data frame that indicates if the corresponding protein binds to the treatment. This information can be obtained from different databases, e.g. UniProt.

group

optional, character column in the data data frame that contains information by which the analysis should be grouped. The analysis will be performed separately for each of the groups. This is most likely a column that labels separate comparisons of different conditions. In protti the assign_missingness() function creates such a column automatically.

treatment_name

a character value that indicates the treatment name. It will be included in the plot title.

plot

a logical value indicating whether the result should be plotted or returned as a table.

fill_colours

a character vector that specifies the fill colours of the plot.

fill_by_group

a logical value that specifies if the bars in the plot should be filled by group if the group argument is provided. Default is FALSE.

facet_n_col

a numeric value that specifies the number of columns the facet plot should have if a group column was provided.

Value

A bar plot displaying the percentage of all detected proteins and all significant proteins that bind to the treatment. A Fisher's exact test is performed to calculate the significance of the enrichment in significant proteins compared to all proteins. The result is reported as a p-value. If plot = FALSE a contingency table in long format is returned.

Examples

# Create example data
data <- data.frame(
  protein_id = c(paste0("protein", 1:50)),
  significant = c(
    rep(TRUE, 20),
    rep(FALSE, 30)
  ),
  binds_treatment = c(
    rep(TRUE, 10),
    rep(FALSE, 10),
    rep(TRUE, 5),
    rep(FALSE, 25)
  ),
  group = c(
    rep("A", 5),
    rep("B", 15),
    rep("A", 15),
    rep("B", 15)
  )
)

# Plot treatment enrichment
calculate_treatment_enrichment(
  data,
  protein_id = protein_id,
  is_significant = significant,
  binds_treatment = binds_treatment,
  treatment_name = "Rapamycin",
  plot = TRUE
)

# Plot treatment enrichment by group
calculate_treatment_enrichment(
  data,
  protein_id = protein_id,
  group = group,
  is_significant = significant,
  binds_treatment = binds_treatment,
  treatment_name = "Rapamycin",
  plot = TRUE,
  fill_by_group = TRUE
)

# Calculate treatment enrichment
enrichment <- calculate_treatment_enrichment(
  data,
  protein_id = protein_id,
  is_significant = significant,
  binds_treatment = binds_treatment,
  plot = FALSE
)

enrichment

Protein abundance correction for LiP-data

Description

Performs the correction of LiP-peptides for changes in protein abundance and calculates their significance using a t-test. This function was implemented based on the MSstatsLiP package developed by the Vitek lab.

Usage

correct_lip_for_abundance(
  lip_data,
  trp_data,
  protein_id,
  grouping,
  comparison = comparison,
  diff = diff,
  n_obs = n_obs,
  std_error = std_error,
  p_adj_method = "BH",
  retain_columns = NULL,
  method = c("satterthwaite", "no_df_approximation")
)

Arguments

lip_data

a data frame containing at least the input variables. Ideally, the result from the calculate_diff_abundance function is used.

trp_data

a data frame containing at least the input variables minus the grouping column. Ideally, the result from the calculate_diff_abundance function is used.

protein_id

a character column in the lip_data and trp_data data frames that contains protein identifiers.

grouping

a character column in the lip_data data frame that contains precursor or peptide identifiers.

comparison

a character column in the lip_data and trp_data data frames that contains the comparisons between conditions.

diff

a numeric column in the lip_data and trp_data data frames that contains log2-fold changes for peptide or protein quantities.

n_obs

a numeric column in the lip_data and trp_data data frames containing the number of observations used to calculate fold changes.

std_error

a numeric column in the lip_data and trp_data data frames containing the standard error of fold changes.

p_adj_method

a character value, specifies the p-value correction method. Possible methods are c("holm", "hochberg", "hommel", "bonferroni", "BH", "BY", "fdr", "none"). Default method is "BH".

retain_columns

a vector indicating if certain columns should be retained from the input data frame. Default is not retaining additional columns retain_columns = NULL. Specific columns can be retained by providing their names (not in quotations marks, just like other column names, but in a vector). Please note that if you retain columns that have multiple rows per grouped variable there will be duplicated rows in the output.

method

a character value, specifies the method used to estimate the degrees of freedom. Possible methods are c("satterthwaite", "no_df_approximation"). satterthwaite uses the Welch-Satterthwaite equation to estimate the pooled degrees of freedom, as described in https://doi.org/10.1016/j.mcpro.2022.100477 and implemented in the MSstatsLiP package. This approach respects the number of protein measurements for the degrees of freedom. no_df_approximation just takes the number of peptides into account when calculating the degrees of freedom.

Value

a data frame containing corrected differential abundances (adj_diff, adjusted standard errors (adj_std_error), degrees of freedom (df), pvalues (pval) and adjusted p-values (adj_pval)

Author(s)

Aaron Fehr

Examples


# Load libraries

library(dplyr)

# Load example data and simulate tryptic data by summing up precursors

data <- rapamycin_10uM

data_trp <- data %>%
  dplyr::group_by(pg_protein_accessions, r_file_name) %>%
  dplyr::mutate(pg_quantity = sum(fg_quantity)) %>%
  dplyr::distinct(
    r_condition,
    r_file_name,
    pg_protein_accessions,
    pg_quantity
  )


# Calculate differential abundances for LiP and Trp data

diff_lip <- data %>%
  dplyr::mutate(fg_intensity_log2 = log2(fg_quantity)) %>%
  assign_missingness(
    sample = r_file_name,
    condition = r_condition,
    intensity = fg_intensity_log2,
    grouping = eg_precursor_id,
    ref_condition = "control",
    retain_columns = "pg_protein_accessions"
  ) %>%
  calculate_diff_abundance(
    sample = r_file_name,
    condition = r_condition,
    grouping = eg_precursor_id,
    intensity_log2 = fg_intensity_log2,
    comparison = comparison,
    method = "t-test",
    retain_columns = "pg_protein_accessions"
  )


diff_trp <- data_trp %>%
  dplyr::mutate(pg_intensity_log2 = log2(pg_quantity)) %>%
  assign_missingness(
    sample = r_file_name,
    condition = r_condition,
    intensity = pg_intensity_log2,
    grouping = pg_protein_accessions,
    ref_condition = "control"
  ) %>%
  calculate_diff_abundance(
    sample = r_file_name,
    condition = r_condition,
    grouping = pg_protein_accessions,
    intensity_log2 = pg_intensity_log2,
    comparison = comparison,
    method = "t-test"
  )

# Correct for abundance changes

corrected <- correct_lip_for_abundance(
  lip_data = diff_lip,
  trp_data = diff_trp,
  protein_id = pg_protein_accessions,
  grouping = eg_precursor_id,
  retain_columns = c("missingness"),
  method = "satterthwaite"
)

head(corrected, n = 10)

Creates a mass spectrometer queue for Xcalibur

Description

[Experimental] This function creates a measurement queue for sample acquisition for the software Xcalibur. All possible combinations of the provided information will be created to make file and sample names.

Usage

create_queue(
  date = NULL,
  instrument = NULL,
  user = NULL,
  measurement_type = NULL,
  experiment_name = NULL,
  digestion = NULL,
  treatment_type_1 = NULL,
  treatment_type_2 = NULL,
  treatment_dose_1 = NULL,
  treatment_dose_2 = NULL,
  treatment_unit_1 = NULL,
  treatment_unit_2 = NULL,
  n_replicates = NULL,
  number_runs = FALSE,
  organism = NULL,
  exclude_combinations = NULL,
  inj_vol = NA,
  data_path = NA,
  method_path = NA,
  position_row = NA,
  position_column = NA,
  blank_every_n = NULL,
  blank_position = NA,
  blank_method_path = NA,
  blank_inj_vol = 1,
  export = FALSE,
  export_to_queue = FALSE,
  queue_path = NULL
)

Arguments

date

optional, character value indicating the start date of the measurements.

instrument

optional, character value indicating the instrument initials.

user

optional, character value indicating the user name.

measurement_type

optional, character value indicating the measurement type of the samples (e.g "DIA", "DDA", "library" etc.).

experiment_name

optional, character value indicating the name of the experiment.

digestion

optional, character vector indicating the digestion types used in this experiment (e.g "LiP" and/or "tryptic control").

treatment_type_1

optional, character vector indicating the name of the treatment.

treatment_type_2

optional, character vector indicating the name of a second treatment that was combined with the first treatment.

treatment_dose_1

optional, numeric vector indicating the doses used for treatment 1. These can be concentrations or times etc.

treatment_dose_2

optional, numeric vector indicating the doses used for treatment 2. These can be concentrations or times etc.

treatment_unit_1

optional, character vector indicating the unit of the doses for treatment 1 (e.g min, mM, etc.).

treatment_unit_2

optional, character vector indicating the unit of the doses for treatment 2 (e.g min, mM, etc.).

n_replicates

optional, a numeric value indicating the number of replicates used per sample.

number_runs

a logical that specifies if file names should be numbered from 1:n instead of adding experiment information. Default is FALSE.

organism

optional, character value indicating the name of the organism used.

exclude_combinations

optional, list of lists that contains vectors of treatment types and treatment doses of which combinations should be excluded from the final queue.

inj_vol

a numeric value indicating the volume used for injection in microliter. Will be NA if not specified. Then it needs to be manually specified before the queue can be used.

data_path

a character value indicating the file path where the MS raw data should be saved. Backslashes should be escaped by another backslash. Will be NA if not specified, but needs to be specified later on then.

method_path

a character value indicating the file path of the MS acquisition method. Backslashes should be escaped by another backslash. Will be NA if not specified, but needs to be specified later on then.

position_row

a character vector that contains row positions that can be used for the samples (e.g c("A", "B")). If the number of specified rows and columns does not equal the total number of samples, positions will be repeated.

position_column

a character vector that contains column positions that can be used for the samples (e.g 8). If the number of specified rows and columns does not equal the total number of samples, positions will be repeated.

blank_every_n

optional, numeric value that specifies in which intervals a blank sample should be inserted.

blank_position

a character value that specifies the plate position of the blank. Will be NA if not specified, but needs to be specified later on then.

blank_method_path

a character value that specifies the file path of the MS acquisition method of the blank. Backslashes should be escaped by another backslash. Will be NA if not specified, but needs to be specified later on then.

blank_inj_vol

a numeric value that specifies the injection volume of the blank sample. Will be NA if not specified, but needs to be specified later on then.

export

a logical value that specifies if the queue should be exported from R and saved as a .csv file. Default is TRUE. Further options for export can be adjusted with the export_to_queue and queue_path arguments.

export_to_queue

a logical value that specifies if the resulting queue should be appended to an already existing queue. If false result will be saved as queue.csv.

queue_path

optional, a character value that specifies the file path to a queue file to which the generated queue should be appended if export_to_queue = TRUE. If not specified queue file can be chosen interactively.

Value

If export_to_queue = FALSE a file named queue.csv will be returned that contains the generated queue. If export_to_queue = TRUE, the resulting generated queue will be appended to an already existing queue that needs to be specified either interactively or through the argument queue_path.

Examples

create_queue(
  date = c("200722"),
  instrument = c("EX1"),
  user = c("jquast"),
  measurement_type = c("DIA"),
  experiment_name = c("JPQ031"),
  digestion = c("LiP", "tryptic control"),
  treatment_type_1 = c("EDTA", "H2O"),
  treatment_type_2 = c("Zeba", "unfiltered"),
  treatment_dose_1 = c(10, 30, 60),
  treatment_unit_1 = c("min"),
  n_replicates = 4,
  number_runs = FALSE,
  organism = c("E. coli"),
  exclude_combinations = list(list(
    treatment_type_1 = c("H2O"),
    treatment_type_2 = c("Zeba", "unfiltered"),
    treatment_dose_1 = c(10, 30)
  )),
  inj_vol = c(2),
  data_path = "D:\\2007_Data",
  method_path = "C:\\Xcalibur\\methods\\DIA_120min",
  position_row = c("A", "B", "C", "D", "E", "F"),
  position_column = 8,
  blank_every_n = 4,
  blank_position = "1-V1",
  blank_method_path = "C:\\Xcalibur\\methods\\blank"
)

Creates a contact map of all atoms from a structure file

Description

Creates a contact map of a subset or of all atom or residue distances in a structure or AlphaFold prediction file. Contact maps are a useful tool for the identification of protein regions that are in close proximity in the folded protein. Additionally, regions that are interacting closely with a small molecule or metal ion can be easily identified without the need to open the structure in programs such as PyMOL or ChimeraX. For large datasets (more than 40 contact maps) it is recommended to use the parallel_create_structure_contact_map() function instead, regardless of if maps should be created in parallel or sequential.

Usage

create_structure_contact_map(
  data,
  data2 = NULL,
  id,
  chain = NULL,
  auth_seq_id = NULL,
  distance_cutoff = 10,
  pdb_model_number_selection = c(0, 1),
  return_min_residue_distance = TRUE,
  show_progress = TRUE,
  export = FALSE,
  export_location = NULL,
  structure_file = NULL
)

Arguments

data

a data frame containing at least a column with PDB ID information of which the name can be provided to the id argument. If only this column is provided, all atom or residue distances are calculated. Additionally, a chain column can be present in the data frame of which the name can be provided to the chain argument. If chains are provided, only distances of this chain relative to the rest of the structure are calculated. Multiple chains can be provided in multiple rows. If chains are provided for one structure but not for another, the rows should contain NAs. Furthermore, specific residue positions can be provided in the auth_seq_id column if the selection should be further reduced. It is not recommended to create full contact maps for more than a few structures due to time and memory limitations. If contact maps are created only for small regions it is possible to create multiple maps at once. By default distances of regions provided in this data frame to the complete structure are computed. If distances of regions from this data frame to another specific subset of regions should be computed, the second subset of regions can be provided through the optional data2 argument.

data2

optional, a data frame that contains a subset of regions for which distances to regions provided in the data data frame should be computed. If regions from the data data frame should be compared to the whole structure, data2 does not need to be provided. This data frame should have the same structure and column names as the data data frame.

id

a character column in the data data frame that contains PDB or UniProt IDs for structures or AlphaFold predictions of which contact maps should be created. If a structure not downloaded directly from PDB is provided (i.e. a locally stored structure file) to the structure_file argument, this column should contain "my_structure" as content.

chain

optional, a character column in the data data frame that contains chain identifiers for the structure file. Identifiers defined by the structure author should be used. Distances will be only calculated between the provided chains and the rest of the structure.

auth_seq_id

optional, a character (or numeric) column in the data data frame that contains semicolon separated positions of regions for which distances should be calculated. This always needs to be provided in combination with a corresponding chain in chain. The position should match the positioning defined by the structure author. For PDB structures this information can be obtained from the find_peptide_in_structure function. The corresponding column in the output is called auth_seq_id. If an AlphaFold prediction is provided, UniProt positions should be used. If signal positions and not stretches of amino acids are provided, the column can be numeric and does not need to contain the semicolon separator.

distance_cutoff

a numeric value specifying the distance cutoff in Angstrom. All values for pairwise comparisons are calculated but only values smaller than this cutoff will be returned in the output. If a cutoff of e.g. 5 is selected then only residues with a distance of 5 Angstrom and less are returned. Using a small value can reduce the size of the contact map drastically and is therefore recommended. The default value is 10.

pdb_model_number_selection

a numeric vector specifying which models from the structure files should be considered for contact maps. E.g. NMR models often have many models in one file. The default for this argument is c(0, 1). This means the first model of each structure file is selected for contact map calculations. For AlphaFold predictions the model number is 0 (only .pdb files), therefore this case is also included here.

return_min_residue_distance

a logical value that specifies if the contact map should be returned for all atom distances or the minimum residue distances. Minimum residue distances are smaller in size. If atom distances are not strictly needed it is recommended to set this argument to TRUE. The default is TRUE.

show_progress

a logical value that specifies if a progress bar will be shown (default is TRUE).

export

a logical value that indicates if contact maps should be exported as ".csv". The name of the file will be the structure ID. Default is export = FALSE.

export_location

optional, a character value that specifies the path to the location in which the contact map should be saved if export = TRUE. If left empty, they will be saved in the current working directory. The location should be provided in the following format "folderA/folderB".

structure_file

optional, a character value that specifies the path to the location and name of a structure file in ".cif" or ".pdb" format for which a contact map should be created. All other arguments can be provided as usual with the exception of the id column in the data data frame, which should not contain a PDB or UniProt ID but a character vector containing only "my_structure".

Value

A list of contact maps for each PDB or UniProt ID provided in the input is returned. If the export argument is TRUE, each contact map will be saved as a ".csv" file in the current working directory or the location provided to the export_location argument.

Examples


# Create example data
data <- data.frame(
  pdb_id = c("6NPF", "1C14", "3NIR"),
  chain = c("A", "A", NA),
  auth_seq_id = c("1;2;3;4;5;6;7", NA, NA)
)

# Create contact map
contact_maps <- create_structure_contact_map(
  data = data,
  id = pdb_id,
  chain = chain,
  auth_seq_id = auth_seq_id,
  return_min_residue_distance = TRUE
)

str(contact_maps[["3NIR"]])

contact_maps


Creates a synthetic limited proteolysis proteomics dataset

Description

This function creates a synthetic limited proteolysis proteomics dataset that can be used to test functions while knowing the ground truth.

Usage

create_synthetic_data(
  n_proteins,
  frac_change,
  n_replicates,
  n_conditions,
  method = "effect_random",
  concentrations = NULL,
  median_offset_sd = 0.05,
  mean_protein_intensity = 16.88,
  sd_protein_intensity = 1.4,
  mean_n_peptides = 12.75,
  size_n_peptides = 0.9,
  mean_sd_peptides = 1.7,
  sd_sd_peptides = 0.75,
  mean_log_replicates = -2.2,
  sd_log_replicates = 1.05,
  effect_sd = 2,
  dropout_curve_inflection = 14,
  dropout_curve_sd = -1.2,
  additional_metadata = TRUE
)

Arguments

n_proteins

a numeric value that specifies the number of proteins in the synthetic dataset.

frac_change

a numeric value that specifies the fraction of proteins that has a peptide changing in abundance. So far only one peptide per protein is changing.

n_replicates

a numeric value that specifies the number of replicates per condition.

n_conditions

a numeric value that specifies the number of conditions.

method

a character value that specifies the method type for the random sampling of significantly changing peptides. If method = "effect_random", the effect for each condition is randomly sampled and conditions do not depend on each other. If method = "dose_response", the effect is sampled based on a dose response curve and conditions are related to each other depending on the curve shape. In this case the concentrations argument needs to be specified.

concentrations

a numeric vector of length equal to the number of conditions, only needs to be specified if method = "dose_response". This allows equal sampling of peptide intensities. It ensures that the same positions of dose response curves are sampled for each peptide based on the provided concentrations.

median_offset_sd

a numeric value that specifies the standard deviation of normal distribution that is used for sampling of inter-sample-differences. Default is 0.05.

mean_protein_intensity

a numeric value that specifies the mean of the protein intensity distribution. Default: 16.8.

sd_protein_intensity

a numeric value that specifies the standard deviation of the protein intensity distribution. Default: 1.4.

mean_n_peptides

a numeric value that specifies the mean number of peptides per protein. Default: 12.75.

size_n_peptides

a numeric value that specifies the dispersion parameter (the shape parameter of the gamma mixing distribution). Can be theoretically calculated as mean + mean^2/variance, however, it should be rather obtained by fitting the negative binomial distribution to real data. This can be done by using the optim function (see Example section). Default: 0.9.

mean_sd_peptides

a numeric value that specifies the mean of peptide intensity standard deviations within a protein. Default: 1.7.

sd_sd_peptides

a numeric value that specifies the standard deviation of peptide intensity standard deviation within a protein. Default: 0.75.

mean_log_replicates, sd_log_replicates

a numeric value that specifies the meanlog and sdlog of the log normal distribution of replicate standard deviations. Can be obtained by fitting a log normal distribution to the distribution of replicate standard deviations from a real dataset. This can be done using the optim function (see Example section). Default: -2.2 and 1.05.

effect_sd

a numeric value that specifies the standard deviation of a normal distribution around mean = 0 that is used to sample the effect of significantly changeing peptides. Default: 2.

dropout_curve_inflection

a numeric value that specifies the intensity inflection point of a probabilistic dropout curve that is used to sample intensity dependent missing values. This argument determines how many missing values there are in the dataset. Default: 14.

dropout_curve_sd

a numeric value that specifies the standard deviation of the probabilistic dropout curve. Needs to be negative to sample a droupout towards low intensities. Default: -1.2.

additional_metadata

a logical value that determines if metadata such as protein coverage, missed cleavages and charge state should be sampled and added to the list.

Value

A data frame that contains complete peptide intensities and peptide intensities with values that were created based on a probabilistic dropout curve.

Examples

create_synthetic_data(
  n_proteins = 10,
  frac_change = 0.1,
  n_replicates = 3,
  n_conditions = 2
)

# determination of mean_n_peptides and size_n_peptides parameters based on real data (count)
# example peptide count per protein
count <- c(6, 3, 2, 0, 1, 0, 1, 2, 2, 0)
theta <- c(mu = 1, k = 1)
negbinom <- function(theta) {
  -sum(stats::dnbinom(count, mu = theta[1], size = theta[2], log = TRUE))
}
fit <- stats::optim(theta, negbinom)
fit

# determination of mean_log_replicates and sd_log_replicates parameters
# based on real data (standard_deviations)

# example standard deviations of replicates
standard_deviations <- c(0.61, 0.54, 0.2, 1.2, 0.8, 0.3, 0.2, 0.6)
theta2 <- c(meanlog = 1, sdlog = 1)
lognorm <- function(theta2) {
  -sum(stats::dlnorm(standard_deviations, meanlog = theta2[1], sdlog = theta2[2], log = TRUE))
}
fit2 <- stats::optim(theta2, lognorm)
fit2

Calculate differential abundance between conditions

Description

[Deprecated] This function was deprecated due to its name changing to calculate_diff_abundance().

Usage

diff_abundance(...)

Value

A data frame that contains differential abundances (diff), p-values (pval) and adjusted p-values (adj_pval) for each protein, peptide or precursor (depending on the grouping variable) and the associated treatment/reference pair. Depending on the method the data frame contains additional columns:


Dose response curve helper function

Description

This function peforms the four-parameter dose response curve fit. It is the helper function for the fit in the fit_drc_4p function.

Usage

drc_4p(data, response, dose, log_logarithmic = TRUE, pb = NULL)

Arguments

data

a data frame that contains at least the dose and response column the model should be fitted to.

response

a numeric column that contains the response values.

dose

a numeric column that contains the dose values.

log_logarithmic

a logical value indicating if a logarithmic or log-logarithmic model is fitted. If response values form a symmetric curve for non-log transformed dose values, a logarithmic model instead of a log-logarithmic model should be used. Usually biological dose response data has a log-logarithmic distribution, which is the reason this is the default. Log-logarithmic models are symmetric if dose values are log transformed.

pb

progress bar object. This is only necessary if the function is used in an iteration.

Value

An object of class drc. If no fit was performed a character vector with content "no_fit".


Plotting of four-parameter dose response curves

Description

Function for plotting four-parameter dose response curves for each group (precursor, peptide or protein), based on output from fit_drc_4p function.

Usage

drc_4p_plot(
  data,
  grouping,
  response,
  dose,
  targets,
  unit = "uM",
  y_axis_name = "Response",
  facet_title_size = 15,
  facet = TRUE,
  scales = "free",
  x_axis_scale_log10 = TRUE,
  x_axis_limits = c(NA, NA),
  colours = NULL,
  export = FALSE,
  export_height = 25,
  export_width = 30,
  export_name = "dose-response_curves"
)

Arguments

data

a data frame that is obtained by calling the fit_drc_4p function.

grouping

a character column in the data data frame that contains the precursor, peptide or protein identifiers.

response

a numeric column in a nested data frame called plot_points that is part of the data data frame. This column contains the response values, e.g. log2 transformed intensities.

dose

a numeric column in a nested data frame called plot_points that is part of the data data frame. This column contains the dose values, e.g. the treatment concentrations.

targets

a character vector that specifies the names of the precursors, peptides or proteins (depending on grouping) that should be plotted. This can also be "all" if plots for all curve fits should be created.

unit

a character value specifying the unit of the concentration.

y_axis_name

a character value specifying the name of the y-axis of the plot.

facet_title_size

a numeric value that specifies the size of the facet title. Default is 15.

facet

a logical value that indicates if plots should be summarised into facets of 20 plots. This is recommended for many plots.

scales

a character value that specifies if the scales in faceted plots (if more than one target was provided) should be "free" or "fixed".

x_axis_scale_log10

a logical value that indicates if the x-axis scale should be log10 transformed.

x_axis_limits

a numeric vector of length 2, defining the lower and upper x-axis limit. The default is c(NA, NA), meaning the limits are not defined by the user but by the data.

colours

a character vector containing at least three colours. The first is used for the points, the second for the confidence interval and the third for the curve. By default the first two protti colours are used for the points and confidence interval and the curve is black.

export

a logical value that indicates if plots should be exported as PDF. The output directory will be the current working directory. The name of the file can be chosen using the export_name argument. If only one target is selected and export = TRUE, the plot is exported and in addition returned in R.

export_height

a numeric value that specifies the plot height in inches for an exported plot. The default is 25. For a non-facet plot we recommend using 8.

export_width

a numeric value that specifies the plot height in inches for an exported plot. The default is 30. For a non-facet plot we recommend using 12.

export_name

a character value providing the name of the exported file if export = TRUE.

Value

If targets = "all" a list containing plots for every unique identifier in the grouping variable is created. Otherwise a plot for the specified targets is created with maximally 20 facets.

Examples


set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 2,
  frac_change = 1,
  n_replicates = 3,
  n_conditions = 8,
  method = "dose_response",
  concentrations = c(0, 1, 10, 50, 100, 500, 1000, 5000),
  additional_metadata = FALSE
)

# Perform dose response curve fit
drc_fit <- fit_drc_4p(
  data = data,
  sample = sample,
  grouping = peptide,
  response = peptide_intensity_missing,
  dose = concentration,
  retain_columns = c(protein)
)

str(drc_fit)

# Plot dose response curves
if (!is.null(drc_fit)) {
  drc_4p_plot(
    data = drc_fit,
    grouping = peptide,
    response = peptide_intensity_missing,
    dose = concentration,
    targets = c("peptide_2_1", "peptide_2_3"),
    unit = "pM"
  )
}


Extract metal-binding protein information from UniProt

Description

Information of metal binding proteins is extracted from UniProt data retrieved with fetch_uniprot as well as QuickGO data retrieved with fetch_quickgo.

Usage

extract_metal_binders(
  data_uniprot,
  data_quickgo,
  data_chebi = NULL,
  data_chebi_relation = NULL,
  data_eco = NULL,
  data_eco_relation = NULL,
  show_progress = TRUE
)

Arguments

data_uniprot

a data frame containing at least the ft_binding, cc_cofactor, cc_catalytic_activity and keyword columns.

data_quickgo

a data frame containing molecular function gene ontology information for at least the proteins of interest. This data should be obtained by calling fetch_quickgo().

data_chebi

optional, a data frame that can be manually obtained with fetch_chebi(stars = c(2, 3)). It should contain 2 and 3 star entries. If not provided it will be fetched within the function. If the function is run many times it is recommended to provide the data frame to save time.

data_chebi_relation

optional, a data frame that can be manually obtained with fetch_chebi(relation = TRUE). If not provided it will be fetched within the function. If the function is run many times it is recommended to provide the data frame to save time.

data_eco

optional, a data frame that contains evidence and conclusion ontology data that can be obtained by calling fetch_eco(). If not provided it will be fetched within the function. If the function is run many times it is recommended to provide the data frame to save time.

data_eco_relation

optional, a data frame that contains relational evidence and conclusion ontology data that can be obtained by calling fetch_eco(return_relation = TRUE). If not provided it will be fetched within the function. If the function is run many times it is recommended to provide the data frame to save time.

show_progress

a logical value that specifies if progress will be shown (default is TRUE).

Value

A data frame containing information on protein metal binding state. It contains the following columns:

For each protein identifier the data frame contains information on the bound ligand as well as on its position if it is known. Since information about metal ligands can come from multiple sources, additional information (e.g. evidence) is nested in the returned data frame. In order to unnest the relevant information the following steps have to be taken: It is possible that there are multiple IDs in the "most_specific_id" column. This means that one position cannot be uniquely attributed to one specific ligand even with the same ligand_identifier. Apart from the "most_specific_id" column, in which those instances are separated by ",", in other columns the relevant information is separated by "||". Then information should be split based on the source (not the source column, that one can be removed from the data frame). There are certain columns associated with specific sources (e.g. go_term is associated with the "go_term" source). Values of columns not relevant for a certain source should be replaced with NA. Since a most_specific_id can have multiple chebi_ids associated with it we need to unnest the chebi_id column and associated columns in which information is separated by "|". Afterwards evidence and additional information can be unnested by first splitting data for ";;" and then for ";". If the "metal_id_part_name" column contains an NA value the indicated ligand position does not directly contact the metal ion. This is usually the case for ligands such as e.g. heme.

Examples


# Create example data

uniprot_ids <- c("P00393", "P06129", "A0A0C5Q309", "A0A0C9VD04")

## UniProt data
data_uniprot <- fetch_uniprot(
  uniprot_ids = uniprot_ids,
  columns = c(
    "ft_binding",
    "cc_cofactor",
    "cc_catalytic_activity",
    "keyword"
  )
)

## QuickGO data
data_quickgo <- fetch_quickgo(
  id_annotations = uniprot_ids,
  ontology_annotations = "molecular_function"
)

## ChEBI data (2 and 3 star entries)
data_chebi <- fetch_chebi(stars = c(2, 3))
data_chebi_relation <- fetch_chebi(relation = TRUE)

## ECO data
eco <- fetch_eco()
eco_relation <- fetch_eco(return_relation = TRUE)

# Extract metal binding information
metal_info <- extract_metal_binders(
  data_uniprot = data_uniprot,
  data_quickgo = data_quickgo,
  data_chebi = data_chebi,
  data_chebi_relation = data_chebi_relation,
  data_eco = eco,
  data_eco_relation = eco_relation
)

metal_info


Fetch AlphaFold aligned error

Description

Fetches the aligned error for AlphaFold predictions for provided proteins. The aligned error is useful for assessing inter-domain accuracy. In detail it represents the expected position error at residue x (scored residue), when the predicted and true structures are aligned on residue y (aligned residue).

Usage

fetch_alphafold_aligned_error(
  uniprot_ids = NULL,
  error_cutoff = 20,
  timeout = 30,
  max_tries = 1,
  version = "v6",
  return_data_frame = FALSE,
  show_progress = TRUE
)

Arguments

uniprot_ids

a character vector of UniProt identifiers for which predictions should be fetched.

error_cutoff

a numeric value specifying the maximum position error (in Angstroms) that should be retained. setting this value to a low number reduces the size of the retrieved data. Default is 20.

timeout

a numeric value specifying the time in seconds until the download times out. The default is 30 seconds.

max_tries

a numeric value that specifies the number of times the function tries to download the data in case an error occurs. The default is 1.

version

a character value that specifies the alphafold version that should be used. This is regularly updated by the database. We always try to make the current version the default version. Available version can be found here: https://ftp.ebi.ac.uk/pub/databases/alphafold/

return_data_frame

a logical value; if TRUE a data frame instead of a list is returned. It is recommended to only use this if information for few proteins is retrieved. Default is FALSE.

show_progress

a logical value; if TRUE a progress bar will be shown. Default is TRUE.

Value

A list that contains aligned errors for AlphaFold predictions. If return_data_frame is TRUE, a data frame with this information is returned instead. The data frame contains the following columns:

Examples


aligned_error <- fetch_alphafold_aligned_error(
  uniprot_ids = c("F4HVG8", "O15552"),
  error_cutoff = 5,
  return_data_frame = TRUE
)

head(aligned_error, n = 10)


Fetch AlphaFold prediction

Description

Fetches atom level data for AlphaFold predictions either for selected proteins or whole organisms.

Usage

fetch_alphafold_prediction(
  uniprot_ids = NULL,
  organism_name = NULL,
  version = "v6",
  timeout = 3600,
  max_tries = 5,
  return_data_frame = FALSE,
  show_progress = TRUE
)

Arguments

uniprot_ids

optional, a character vector of UniProt identifiers for which predictions should be fetched. This argument is mutually exclusive to the organism_name argument.

organism_name

optional, a character value providing the name of an organism for which all available AlphaFold predictions should be retreived. The name should be the capitalised scientific species name (e.g. "Homo sapiens"). Note: Some organisms contain a lot of predictions which might take a considerable amount of time and memory to fetch. Therefore, you should be sure that your system can handle fetching predictions for these organisms. This argument is mutually exclusive to the uniprot_ids argument.

version

a character value that specifies the alphafold version that should be used. This is regularly updated by the database. We always try to make the current version the default version. Available version can be found here: https://ftp.ebi.ac.uk/pub/databases/alphafold/

timeout

a numeric value specifying the time in seconds until the download of an organism archive times out. The default is 3600 seconds.

max_tries

a numeric value that specifies the number of times the function tries to download the data in case an error occurs. The default is 5. This only applies if uniprot_ids were provided.

return_data_frame

a logical value that specifies if true, a data frame instead of a list is returned. It is recommended to only use this if information for few proteins is retrieved. Default is FALSE.

show_progress

a logical value that specifies if true, a progress bar will be shown. Default is TRUE.

Value

A list that contains atom level data for AlphaFold predictions. If return_data_frame is TRUE, a data frame with this information is returned instead. The data frame contains the following columns:

Examples


alphafold <- fetch_alphafold_prediction(
  uniprot_ids = c("F4HVG8", "O15552"),
  return_data_frame = TRUE
)

head(alphafold, n = 10)


Fetch ChEBI database information

Description

Fetches information from the ChEBI database.

Usage

fetch_chebi(relation = FALSE, stars = c(3), timeout = 60)

Arguments

relation

a logical value that indicates if ChEBI Ontology data will be returned instead the main compound data. This data can be used to check the relations of ChEBI ID's to each other. Default is FALSE.

stars

a numeric vector indicating the "star" level (confidence) for which entries should be retrieved (Possible levels are 1, 2 and 3). Default is c(3) retrieving only "3-star" entries, which are manually annotated by the ChEBI curator team.

timeout

a numeric value specifying the time in seconds until the download of an organism archive times out. The default is 60 seconds.

Value

A data frame that contains information about each molecule in the ChEBI database.

Examples


chebi <- fetch_chebi()

head(chebi)


Fetch evidence & conclusion ontology

Description

Fetches all evidence & conclusion ontology (ECO) information from the QuickGO EBI database. The ECO project is maintained through a public GitHub repository.

Usage

fetch_eco(
  return_relation = FALSE,
  return_history = FALSE,
  show_progress = TRUE
)

Arguments

return_relation

a logical value that indicates if relational information should be returned instead the main descriptive information. This data can be used to check the relations of ECO terms to each other. Default is FALSE.

return_history

a logical value that indicates if the entry history of an ECO term should be returned instead the main descriptive information. Default is FALSE.

show_progress

a logical value that indicates if a progress bar will be shown. Default is TRUE.

Details

According to the GitHub repository ECO is defined as follows:

"The Evidence & Conclusion Ontology (ECO) describes types of scientific evidence within the biological research domain that arise from laboratory experiments, computational methods, literature curation, or other means. Researchers use evidence to support conclusions that arise out of scientific research. Documenting evidence during scientific research is essential, because evidence gives us a sense of why we believe what we think we know. Conclusions are asserted as statements about things that are believed to be true, for example that a protein has a particular function (i.e. a protein functional annotation) or that a disease is associated with a particular gene variant (i.e. a phenotype-gene association). A systematic and structured (i.e. ontological) classification of evidence allows us to store, retreive, share, and compare data associated with that evidence using computers, which are essential to navigating the ever-growing (in size and complexity) corpus of scientific information."

More information can be found in their publication (doi:10.1093/nar/gky1036).

Value

A data frame that contains descriptive information about each ECO term in the EBI database. If either return_relation or return_history is set to TRUE, the respective information is returned instead of the usual output.

Examples


eco <- fetch_eco()

head(eco)


Fetch gene ontology information from geneontology.org

Description

Fetches gene ontology data from geneontology.org for the provided organism ID.

Usage

fetch_go(organism_id)

Arguments

organism_id

a character value NCBI taxonomy identifier of an organism (TaxId). Possible inputs inlude only: "9606" (Human), "559292" (Yeast) and "83333" (E. coli).

Value

A data frame that contains gene ontology mappings to UniProt or SGD IDs. The original file is a .GAF file. A detailed description of all columns can be found here: http://geneontology.org/docs/go-annotation-file-gaf-format-2.1/

Examples


go <- fetch_go("9606")

head(go)


Fetch domain and residue information from InterPro

Description

Fetches either domain level information with e.g. gene ontology annotations or residue level information from the InterPro database.

Usage

fetch_interpro(
  uniprot_ids = NULL,
  return_residue_info = FALSE,
  manual_query = NULL,
  page_size = 200,
  max_tries = 3,
  timeout = 20,
  show_progress = TRUE
)

Arguments

uniprot_ids

a character vector of UniProt accession numbers.

return_residue_info

a logical value that specifies if either domain or residue information should be returned by the function. The default is FALSE.

manual_query

optional, a character value that is a custom query to the InterPro database. This query is pastes after "https://www.ebi.ac.uk/interpro/api/" and before "&page_size=200". The raw data of the query is returned as a list.

page_size

a numeric value that specifies the number of entries that should be retrieved per page of a request. The function anyway iterates through all pages, but this parameters allows you to finetune the number of iterations and thus number of requests to the database. Default is 200.

max_tries

a numeric value that specifies the number of times the function tries to download the data in case an error occurs. The default is 3.

timeout

a numeric value that specifies the maximum request time per try. Default is 20 seconds.

show_progress

a logical value that determines if a progress bar will be shown. Default is TRUE.

Value

A data frame that contains either domain or residue level information for the provided UniProt IDs.

Examples


uniprot_ids <- c("P36578", "O43324", "Q00796", "O32583")

domain_info <- fetch_interpro(uniprot_ids = uniprot_ids)

head(domain_info)

residue_info <- fetch_interpro(
  uniprot_ids = uniprot_ids,
  return_residue_info = TRUE
)

head(residue_info)


Fetch KEGG pathway data from KEGG

Description

Fetches gene IDs and corresponding pathway IDs and names for the provided organism.

Usage

fetch_kegg(species)

Arguments

species

a character value providing an abreviated species name. "hsa" for human, "eco" for E. coli and "sce" for S. cerevisiae. Additional possible names can be found for eukaryotes and for prokaryotes.

Value

A data frame that contains gene IDs with corresponding pathway IDs and names for a selected organism.

Examples


kegg <- fetch_kegg(species = "hsa")

head(kegg)


Fetch structural information about protein-metal binding from MetalPDB

Description

Fetches information about protein-metal binding sites from the MetalPDB database. A complete list of different possible search queries can be found on their website.

Usage

fetch_metal_pdb(
  id_type = "uniprot",
  id_value,
  site_type = NULL,
  pfam = NULL,
  cath = NULL,
  scop = NULL,
  representative = NULL,
  metal = NULL,
  ligands = NULL,
  geometry = NULL,
  coordination = NULL,
  donors = NULL,
  columns = NULL,
  show_progress = TRUE
)

Arguments

id_type

a character value that specifies the type of the IDs provided to id_value. Default is "uniprot". Possible options include: "uniprot", "pdb", "ec_number", "molecule" and "organism".

id_value

a character vector supplying IDs that are of the ID type that was specified in id_type. E.g. UniProt IDs. Information for these IDs will be retreived.

site_type

optional, a character value that specifies a nuclearity for which information should be retrieved. The specific nuclearity can be supplied as e.g. "tetranuclear".

pfam

optional, a character value that specifies a Pfam domain for which information should be retrieved. The domain can be specified as e.g. "Carb_anhydrase".

cath

optional, a character value that specifies a CATH ID for which information should be retrieved. The ID can be specified as e.g. "3.10.200.10".

scop

optional, a character value that specifies a SCOP ID for which information should be retrieved. The ID can be specified as e.g. "b.74.1.1".

representative

optional, a logical that indicates if only information of representative sites of a family should be retrieved it can be specified here. A representative site is a site selected to represent a cluster of equivalent sites. The selection is done by choosing the PDB structure with the best X-ray resolution among those containing the sites in the cluster. NMR structures are generally discarded in favor of X-ray structures, unless all the sites in the cluster are found in NMR structures. If it is TRUE, only representative sites are retrieved, if it is FALSE, all sites are retrieved.

metal

optional, a character value that specifies a metal for which information should be retrieved. The metal can be specified as e.g. "Zn".

ligands

optional, a character value that specifies a metal ligand residue for which information should be retrieved. The ligand can be specified as e.g. "His".

geometry

optional, a character value that specifies a metal site geometry for which information should be retrieved. The geometry can be specified here based on the three letter code for geometries provided on their website.

coordination

optional, a character value that specifies a coordination number for which information should be retrieved. The number can be specified as e.g. "3".

donors

optional, a character value that specifies a metal ligand atom for which information should be retrieved. The atom can be specified as e.g. "S" for sulfur.

columns

optional, a character vector that specifies specific columns that should be retrieved based on the MetalPDB website. If nothing is supplied here, all possible columns will be retrieved.

show_progress

logical, if true, a progress bar will be shown. Default is TRUE.

Value

A data frame that contains information about protein-metal binding sites. The data frame contains some columns that might not be self explanatory.

Examples


head(fetch_metal_pdb(id_value = c("P42345", "P00918")))

fetch_metal_pdb(id_type = "pdb", id_value = c("1g54"), metal = "Zn")



Fetch protein disorder and mobility information from MobiDB

Description

Fetches information about disordered and flexible protein regions from MobiDB.

Usage

fetch_mobidb(
  uniprot_ids = NULL,
  organism_id = NULL,
  show_progress = TRUE,
  timeout = 60,
  max_tries = 2
)

Arguments

uniprot_ids

optional, a character vector of UniProt identifiers for which information should be fetched. This argument is mutually exclusive to the organism_id argument.

organism_id

optional, a character value providing the NCBI taxonomy identifier of an organism (TaxId) of an organism for which all available information should be retreived. This argument is mutually exclusive to the uniprot_ids argument.

show_progress

a logical value; if TRUE a progress bar will be shown. Default is TRUE.

timeout

a numeric value specifying the time in seconds until the download of an organism archive times out. The default is 60 seconds.

max_tries

a numeric value that specifies the number of times the function tries to download the data in case an error occurs. The default is 2.

Value

A data frame that contains start and end positions for disordered and flexible protein regions. The feature column contains information on the source of this annotation. More information on the source can be found here.

Examples


fetch_mobidb(
  uniprot_ids = c("P0A799", "P62707")
)


Fetch structure information from RCSB

Description

Fetches structure metadata from RCSB. If you want to retrieve atom data such as positions, use the function fetch_pdb_structure().

Usage

fetch_pdb(pdb_ids, batchsize = 100, show_progress = TRUE)

Arguments

pdb_ids

a character vector of PDB identifiers.

batchsize

a numeric value that specifies the number of structures to be processed in a single query. Default is 100.

show_progress

a logical value that indicates if a progress bar will be shown. Default is TRUE.

Value

A data frame that contains structure metadata for the PDB IDs provided. The data frame contains some columns that might not be self explanatory.

Examples


pdb <- fetch_pdb(pdb_ids = c("6HG1", "1E9I", "6D3Q", "4JHW"))

head(pdb)


Fetch PDB structure atom data from RCSB

Description

Fetches atom data for a PDB structure from RCSB. If you want to retrieve metadata about PDB structures, use the function fetch_pdb(). The information retrieved is based on the .cif file of the structure, which may vary from the .pdb file.

Usage

fetch_pdb_structure(pdb_ids, return_data_frame = FALSE, show_progress = TRUE)

Arguments

pdb_ids

a character vector of PDB identifiers.

return_data_frame

a logical value that indicates if a data frame instead of a list is returned. It is recommended to only use this if not many pdb structures are retrieved. Default is FALSE.

show_progress

a logical value that indicates if a progress bar will be shown. Default is TRUE.

Value

A list that contains atom data for each PDB structures provided. If return_data_frame is TRUE, a data frame with this information is returned instead. The data frame contains the following columns:

Examples


pdb_structure <- fetch_pdb_structure(
  pdb_ids = c("6HG1", "1E9I", "6D3Q", "4JHW"),
  return_data_frame = TRUE
)

head(pdb_structure, n = 10)


Fetch information from the QuickGO API

Description

Fetches gene ontology (GO) annotations, terms or slims from the QuickGO EBI database. Annotations can be retrieved for specific UniProt IDs or NCBI taxonomy identifiers. When terms are retrieved, a complete list of all GO terms is returned. For the generation of a slim dataset you can provide GO IDs that should be considered. A slim dataset is a subset GO dataset that considers all child terms of the supplied IDs.

Usage

fetch_quickgo(
  type = "annotations",
  id_annotations = NULL,
  taxon_id_annotations = NULL,
  ontology_annotations = "all",
  go_id_slims = NULL,
  relations_slims = c("is_a", "part_of", "regulates", "occurs_in"),
  timeout = 1200,
  max_tries = 2,
  show_progress = TRUE
)

Arguments

type

a character value that indicates if gene ontology terms, annotations or slims should be retrieved. The possible values therefore include "annotations", "terms" and "slims". If annotations are retrieved, the maximum number of results is 2,000,000.

id_annotations

an optional character vector that specifies UniProt IDs for which GO annotations should be retrieved. This argument should only be provided if annotations are retrieved.

taxon_id_annotations

an optional character value that specifies the NCBI taxonomy identifier (TaxId) for an organism for which GO annotations should be retrieved. This argument should only be provided if annotations are retrieved.

ontology_annotations

an optional character value that specifies the ontology that should be retrieved. This can either have the values "all", "molecular_function", "biological_process" or "cellular_component". This argument should only be provided if annotations are retrieved.

go_id_slims

an optional character vector that specifies gene ontology IDs (e.g. GO:0046872) for which a slim go set should be generated. This argument should only be provided if slims are retrieved.

relations_slims

an optional character vector that specifies the relations of GO IDs that should be considered for the generation of the slim dataset. This argument should only be provided if slims are retrieved.

timeout

a numeric value specifying the time in seconds until the download times out. The default is 1200 seconds.

max_tries

a numeric value that specifies the number of times the function tries to download the data in case an error occurs. The default is 2.

show_progress

a logical value that indicates if a progress bar will be shown. Default is TRUE.

Value

A data frame that contains descriptive information about gene ontology annotations, terms or slims depending on what the input "type" was.

Examples


# Annotations
annotations <- fetch_quickgo(
  type = "annotations",
  id = c("P63328", "Q4FFP4"),
  ontology = "molecular_function"
)

head(annotations)

# Terms
terms <- fetch_quickgo(type = "terms")

head(terms)

# Slims
slims <- fetch_quickgo(
  type = "slims",
  go_id_slims = c("GO:0046872", "GO:0051540")
)

head(slims)


Fetch protein data from UniProt

Description

Fetches protein metadata from UniProt.

Usage

fetch_uniprot(
  uniprot_ids,
  columns = c("protein_name", "length", "sequence", "gene_names", "xref_geneid",
    "xref_string", "go_f", "go_p", "go_c", "cc_interaction", "ft_act_site", "ft_binding",
    "cc_cofactor", "cc_catalytic_activity", "xref_pdb", "keyword"),
  batchsize = 100,
  max_tries = 10,
  timeout = 20,
  show_progress = TRUE
)

Arguments

uniprot_ids

a character vector of UniProt accession numbers.

columns

a character vector of metadata columns that should be imported from UniProt (all possible columns can be found here. For cross-referenced database provide the database name with the prefix "xref_", e.g. "xref_pdb")

batchsize

a numeric value that specifies the number of proteins processed in a single single query. Default and max value is 100.

max_tries

a numeric value that specifies the number of times the function tries to download the data in case an error occurs. The default is 10.

timeout

a numeric value that specifies the maximum request time per try. Default is 20 seconds.

show_progress

a logical value that determines if a progress bar will be shown. Default is TRUE.

Value

A data frame that contains all protein metadata specified in columns for the proteins provided. The input_id column contains the provided UniProt IDs. If an invalid ID was provided that contains a valid UniProt ID, the valid portion of the ID is still fetched and present in the accession column, while the input_id column contains the original not completely valid ID.

Examples


fetch_uniprot(c("P36578", "O43324", "Q00796"))

# Not completely valid ID
fetch_uniprot(c("P02545", "P02545;P20700"))


Fetch proteome data from UniProt

Description

Fetches proteome data from UniProt for the provided organism ID.

Usage

fetch_uniprot_proteome(
  organism_id,
  columns = c("accession"),
  reviewed = TRUE,
  timeout = 120,
  max_tries = 5
)

Arguments

organism_id

a numeric value that specifies the NCBI taxonomy identifier (TaxId) for an organism.

columns

a character vector of metadata columns that should be imported from UniProt (all possible columns can be found here. For cross-referenced database provide the database name with the prefix "xref_", e.g. "xref_pdb"). Note: Not more than one or two columns should be selected otherwise the function will not be able to efficiently retrieve the information. If more information is needed, fetch_uniprot() can be used with the IDs retrieved by this function.

reviewed

a logical value that determines if only reviewed protein entries will be retrieved.

timeout

a numeric value specifying the time in seconds until the download times out. The default is 60 seconds.

max_tries

a numeric value that specifies the number of times the function tries to download the data in case an error occurs. The default is 2.

Value

A data frame that contains all protein metadata specified in columns for the organism of choice.

Examples


head(fetch_uniprot_proteome(9606))


Data filtering based on coefficients of variation (CV)

Description

Filters the input data based on precursor, peptide or protein intensity coefficients of variation. The function should be used to ensure that only robust measurements and quantifications are used for data analysis. It is advised to use the function after inspection of raw values (quality control) and median normalisation. Generally, the function calculates CVs of each peptide, precursor or protein for each condition and removes peptides, precursors or proteins that have a CV above the cutoff in less than the (user-defined) required number of conditions. Since the user-defined cutoff is fixed and does not depend on the number of conditions that have detected values, the function might bias for data completeness.

Usage

filter_cv(
  data,
  grouping,
  condition,
  log2_intensity,
  cv_limit = 0.25,
  min_conditions,
  silent = FALSE
)

Arguments

data

a data frame that contains at least the input variables.

grouping

a character column in the data data frame that contains the grouping variable that can be either precursors, peptides or proteins.

condition

a character or numeric column in the data data frame that contains information on the sample condition.

log2_intensity

a numeric column in the data data frame that contains log2 transformed intensities.

cv_limit

optional, a numeric value that specifies the CV cutoff that will be applied. Default is 0.25.

min_conditions

a numeric value that specifies the minimum number of conditions for which grouping CVs should be below the cutoff.

silent

a logical value that specifies if a message with the number of filtered out conditions should be returned. Default is FALSE.

Value

The CV filtered data frame.

Examples

set.seed(123) # Makes example reproducible

# Create synthetic data
data <- create_synthetic_data(
  n_proteins = 50,
  frac_change = 0.05,
  n_replicates = 3,
  n_conditions = 2,
  method = "effect_random",
  additional_metadata = FALSE
)

# Filter coefficients of variation
data_filtered <- filter_cv(
  data = data,
  grouping = peptide,
  condition = condition,
  log2_intensity = peptide_intensity_missing,
  cv_limit = 0.25,
  min_conditions = 2
)

Find all sub IDs of an ID in a network

Description

For a given ID, find all sub IDs and their sub IDs etc. The type of relationship can be selected too. This is a helper function for other functions.

Usage

find_all_subs(
  data,
  ids,
  main_id = id,
  type = type,
  accepted_types = "is_a",
  exclude_parent_id = FALSE
)

Arguments

data

a data frame that contains relational information on IDs (main_id) their sub IDs (sub_id) and their relationship (type). For ChEBI this data frame can be obtained by calling fetch_chebi(relation = TRUE). For ECO data it can be obtained by calling fetch_eco(relation = TRUE).

ids

a character vector of IDs for which sub IDs should be searched.

main_id

a character or integer column containing IDs. Default is id for ChEBI IDs.

type

a character column that contains the type of interactions. Default is type for ChEBI IDs.

accepted_types

a character vector containing the accepted_types of relationships that should be considered for the search. It is possible to use "all" relationships. The default type is "is_a". A list of possible relationships for e.g. ChEBI IDs can be found here.

exclude_parent_id

a logical value that specifies if the parent ID should be included in the returned list.

Value

A list of character vectors containing the provided ID and all of its sub IDs. It contains one element per input ID.


Find ChEBI IDs for name patterns

Description

Search for chebi IDs that match a specific name pattern. A list of corresponding ChEBI IDs is returned.

Usage

find_chebis(chebi_data, pattern)

Arguments

chebi_data

a data frame that contains at least information on ChEBI IDs (id) and their names (name). This data frame can be obtained by calling fetch_chebi(). Ideally this should be subsetted to only contain molecules of a specific type e.g. metals. This can be achieved by calling find_all_subs with a general ID such as "25213" (Metal cation) and then subset the complete ChEBI database to only include the returned sub-IDs. Using a subsetted database ensures better search results. This is a helper function for other functions.

pattern

a character vector that contains names or name patterns of molecules. Name patterns can be for example obtained with the split_metal_name function.

Value

A list of character vectors containing ChEBI IDs that have a name matching the supplied pattern. It contains one element per pattern.


Find peptide location

Description

The position of the given peptide sequence is searched within the given protein sequence. In addition the last amino acid of the peptide and the amino acid right before are reported.

Usage

find_peptide(data, protein_sequence, peptide_sequence)

Arguments

data

a data frame that contains at least the protein and peptide sequence.

protein_sequence

a character column in the data data frame that contains the protein sequence.

peptide_sequence

a character column in the data data frame that contains the peptide sequence.

Value

A data frame that contains the input data and four additional columns with peptide start and end position, the last amino acid and the amino acid before the peptide.

Examples

# Create example data
data <- data.frame(
  protein_sequence = c("abcdefg"),
  peptide_sequence = c("cde")
)

# Find peptide
find_peptide(
  data = data,
  protein_sequence = protein_sequence,
  peptide_sequence = peptide_sequence
)

Finds peptide positions in a PDB structure based on positional matching

Description

Finds peptide positions in a PDB structure. Often positions of peptides in UniProt and a PDB structure are different due to different lengths of structures. This function maps a peptide based on its UniProt positions onto a PDB structure. This method is superior to sequence alignment of the peptide to the PDB structure sequence, since it can also match the peptide if there are truncations or mismatches. This function also provides an easy way to check if a peptide is present in a PDB structure.

Usage

find_peptide_in_structure(
  peptide_data,
  peptide,
  start,
  end,
  uniprot_id,
  pdb_data = NULL,
  retain_columns = NULL
)

Arguments

peptide_data

a data frame containing at least the input columns to this function.

peptide

a character column in the peptide_data data frame that contains the sequence or any other unique identifier for the peptide that should be found.

start

a numeric column in the peptide_data data frame that contains start positions of peptides.

end

a numeric column in the peptide_data data frame that contains end positions of peptides.

uniprot_id

a character column in the peptide_data data frame that contains UniProt identifiers that correspond to the peptides.

pdb_data

optional, a data frame containing data obtained with fetch_pdb(). If not provided, information is fetched automatically. If this function should be run multiple times it is faster to fetch the information once and provide it to the function. If provided, make sure that the column names are identical to the ones that would be obtained by calling fetch_pdb().

retain_columns

a vector indicating if certain columns should be retained from the input data frame. Default is not retaining additional columns retain_columns = NULL. Specific columns can be retained by providing their names (not in quotations marks, just like other column names, but in a vector).

Value

A data frame that contains peptide positions in the corresponding PDB structures. If a peptide is not found in any structure or no structure is associated with the protein, the data frame contains NAs values for the output columns. The data frame contains the following and additional columns:

Examples


# Create example data
peptide_data <- data.frame(
  uniprot_id = c("P0A8T7", "P0A8T7", "P60906"),
  peptide_sequence = c(
    "SGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNV",
    "NVFEGERVER",
    "AIGEVTDVVEKE"
  ),
  start = c(1160, 1197, 55),
  end = c(1198, 1206, 66)
)

# Find peptides in protein structure
peptide_in_structure <- find_peptide_in_structure(
  peptide_data = peptide_data,
  peptide = peptide_sequence,
  start = start,
  end = end,
  uniprot_id = uniprot_id
)

head(peptide_in_structure, n = 10)


Fitting four-parameter dose response curves

Description

Function for fitting four-parameter dose response curves for each group (precursor, peptide or protein). In addition it can annotate data based on completeness, the completeness distribution and statistical testing using ANOVA. Filtering by the function is only performed based on completeness if selected.

Usage

fit_drc_4p(
  data,
  sample,
  grouping,
  response,
  dose,
  filter = "post",
  replicate_completeness = 0.7,
  condition_completeness = 0.5,
  n_replicate_completeness = NULL,
  n_condition_completeness = NULL,
  complete_doses = NULL,
  anova_cutoff = 0.05,
  correlation_cutoff = 0.8,
  log_logarithmic = TRUE,
  include_models = FALSE,
  retain_columns = NULL
)

Arguments

data

a data frame that contains at least the input variables.

sample

a character column in the data data frame that contains the sample names.

grouping

a character column in the data data frame that contains the precursor, peptide or protein identifiers.

response

a numeric column in the data data frame that contains the response values, e.g. log2 transformed intensities.

dose

a numeric column in the data data frame that contains the dose values, e.g. the treatment concentrations.

filter

a character value that can either be "pre", "post" or "none". The data is annotated for completeness, ANOVA significance and the completeness distribution along the doses ("pre" and "post"). The combined output of this filtering step can be found in the passed_filter column and depends on the cutoffs provided to the function. Note that this is only an annotation and nothing is removed from the output. If "pre" is selected then, in addition to the annotation, the data is filtered for completeness based on the condition completeness prior to the curve fitting and ANOVA calculation and p-value adjustment. This has the benefit that less curves need to be fitted and that the ANOVA p-value adjustment is done only on the relevant set of tests. If "none" is selected the data will be neither annotated nor filtered.

replicate_completeness

[Deprecated] please use n_replicate_completeness instead. A numeric value which similar to completenss_MAR of the assign_missingness function sets a threshold for the completeness of data. In contrast to assign_missingness it only determines the completeness for one condition and not the comparison of two conditions. The threshold is used to calculate a minimal degree of data completeness. The value provided to this argument has to be between 0 and 1, default is 0.7. It is multiplied with the number of replicates and then adjusted downward. The resulting number is the minimal number of observations that a condition needs to have to be considered "complete enough" for the condition_completeness argument.

condition_completeness

[Deprecated] please use n_condition_completeness instead. A numeric value which determines how many conditions need to at least fulfill the "complete enough" criteria set with replicate_completeness. The value provided to this argument has to be between 0 and 1, default is 0.5. It is multiplied with the number of conditions and then adjusted downward. The resulting number is the minimal number of conditions that need to fulfill the replicate_completeness argument for a peptide to pass the filtering.

n_replicate_completeness

a numeric value that defines the minimal number of observations that a condition (concentration) needs to have to be considered "complete enough" for the n_condition_completeness argument. E.g. if each concentration has 4 replicates this argument could be set to 3 to allow for one replicate to be missing for the completeness criteria.

n_condition_completeness

a numeric value that defines the minimal number of conditions that need to fulfill the n_replicate_completeness argument for a feature to pass the filtering. E.g. if an experiment has 12 concentrations, this argument could be set to 6 to define that at least 6 of 12 concentrations need to make the replicate completeness cutoff.

complete_doses

an optional numeric vector that supplies all the actually used doses (concentrations) to the function. Usually the function extracts this information from the supplied data. However, for incomplete datasets the total number of assumed doses might be wrong. Therefore, it becomes important to provide this argument when the dataset is small and potentially incomplete. This information is only used for the missing not at random (MNAR) estimations.

anova_cutoff

a numeric value that specifies the ANOVA adjusted p-value cutoff used for data filtering. Any fits with an adjusted ANOVA p-value bellow the cutoff will be considered for scoring. The default is 0.05.

correlation_cutoff

a numeric value that specifies the correlation cutoff used for data filtering. Any fits with a correlation above the cutoff will be considered for scoring.

log_logarithmic

a logical value that indicates if a logarithmic or log-logarithmic model is fitted. If response values form a symmetric curve for non-log transformed dose values, a logarithmic model instead of a log-logarithmic model should be used. Usually biological dose response data has a log-logarithmic distribution, which is the reason this is the default. Log-logarithmic models are symmetric if dose values are log transformed.

include_models

a logical value that indicates if model fit objects should be exported. These are usually very large and not necessary for further analysis.

retain_columns

a vector that specifies columns that should be retained from the input data frame. Default is not retaining additional columns retain_columns = NULL. Specific columns can be retained by providing their names (not in quotations marks, just like other column names, but in a vector).

Details

If data filtering options are selected, data is annotated based on multiple criteria. If "post" is selected the data is annotated based on completeness, the completeness distribution, the adjusted ANOVA p-value cutoff and a correlation cutoff. Completeness of features is determined based on the n_replicate_completeness and n_condition_completeness arguments. The completeness distribution determines if there is a distribution of not random missingness of data along the dose. For this it is checked if half of a features values (+/-1 value) pass the replicate completeness criteria and half do not pass it. In order to fall into this category, the values that fulfill the completeness cutoff and the ones that do not fulfill it need to be consecutive, meaning located next to each other based on their concentration values. Furthermore, the values that do not pass the completeness cutoff need to be lower in intensity. Lastly, the difference between the two groups is tested for statistical significance using a Welch's t-test and a cutoff of p <= 0.1 (we want to mainly discard curves that falsely fit the other criteria but that have clearly non-significant differences in mean). This allows curves to be considered that have missing values in half of their observations due to a decrease in intensity. It can be thought of as conditions that are missing not at random (MNAR). It is often the case that those entities do not have a significant p-value since half of their conditions are not considered due to data missingness. The ANOVA test is performed on the features by concentration. If it is significant it is likely that there is some response. However, this test would also be significant even if there is one outlier concentration so it should only be used only in combination with other cutoffs to determine if a feature is significant. The passed_filter column is TRUE for all the features that pass the above mentioned criteria and that have a correlation greater than the cutoff (default is 0.8) and the adjusted ANOVA p-value below the cutoff (default is 0.05).

The final list is ranked based on a score calculated on entities that pass the filter. The score is the negative log10 of the adjusted ANOVA p-value scaled between 0 and 1 and the correlation scaled between 0 and 1 summed up and divided by 2. Thus, the highest score an entity can have is 1 with both the highest correlation and adjusted p-value. The rank is corresponding to this score. Please note, that entities with MNAR conditions might have a lower score due to the missing or non-significant ANOVA p-value. If no score could be calculated the usual way these cases receive a score of 0. You should have a look at curves that are TRUE for dose_MNAR in more detail.

If the "pre" option is selected for the filter argument then the data is filtered for completeness prior to curve fitting and the ANOVA test. Otherwise annotation is performed exactly as mentioned above. We recommend the "pre" option because it leaves you with not only the likely hits of your treatment, but also with rather high confidence true negative results. This is because the filtered data has a high degree of completeness making it unlikely that a real dose-response curve is missed due to data missingness.

Please note that in general, curves are only fitted if there are at least 5 conditions with data points present to ensure that there is potential for a good curve fit. This is done independent of the selected filtering option.

Value

If include_models = FALSE a data frame is returned that contains correlations of predicted to measured values as a measure of the goodness of the curve fit, an associated p-value and the four parameters of the model for each group. Furthermore, input data for plots is returned in the columns plot_curve (curve and confidence interval) and plot_points (measured points). If include_models = TURE, a list is returned that contains:

Examples


# Load libraries
library(dplyr)

set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 2,
  frac_change = 1,
  n_replicates = 3,
  n_conditions = 8,
  method = "dose_response",
  concentrations = c(0, 1, 10, 50, 100, 500, 1000, 5000),
  additional_metadata = FALSE
)

# Perform dose response curve fit
drc_fit <- fit_drc_4p(
  data = data,
  sample = sample,
  grouping = peptide,
  response = peptide_intensity_missing,
  dose = concentration,
  n_replicate_completeness = 2,
  n_condition_completeness = 5,
  retain_columns = c(protein, change_peptide)
)

glimpse(drc_fit)

head(drc_fit, n = 10)


Perform gene ontology enrichment analysis

Description

[Deprecated] This function was deprecated due to its name changing to calculate_go_enrichment().

Usage

go_enrichment(...)

Value

A bar plot displaying negative log10 adjusted p-values for the top 10 enriched or depleted gene ontology terms. Alternatively, plot cutoffs can be chosen individually with the plot_cutoff argument. Bars are colored according to the direction of the enrichment (enriched or deenriched). If plot = FALSE, a data frame is returned. P-values are adjusted with Benjamini-Hochberg.


Imputation of missing values

Description

impute is calculating imputation values for missing data depending on the selected method.

Usage

impute(
  data,
  sample,
  grouping,
  intensity_log2,
  condition,
  comparison = comparison,
  missingness = missingness,
  noise = NULL,
  method = "ludovic",
  skip_log2_transform_error = FALSE,
  retain_columns = NULL
)

Arguments

data

a data frame that is ideally the output from the assign_missingness function. It should containing at least the input variables. For each "reference_vs_treatment" comparison, there should be the pair of the reference and treatment condition. That means the reference condition should be doublicated once for every treatment.

sample

a character column in the data data frame that contains the sample names.

grouping

a character column in the data data frame that contains the precursor or peptide identifiers.

intensity_log2

a numeric column in the data data frame that contains the intensity values.

condition

a character or numeric column in the data data frame that contains the the conditions.

comparison

a character column in the data data frame that contains the the comparisons of treatment/reference pairs. This is an output of the assign_missingnes function.

missingness

a character column in the data data frame that contains the missingness type of the data determines how values for imputation are sampled. This should at least contain "MAR" or "MNAR". Missingness assigned as NA will not be imputed.

noise

a numeric column in the data data frame that contains the noise value for the precursor/peptide. Is only required if method = "noise". Note: Noise values need to be log2 transformed.

method

a character value that specifies the method to be used for imputation. For method = "ludovic", MNAR missingness is sampled from a normal distribution around a value that is three lower (log2) than the lowest intensity value recorded for the precursor/peptide and that has a spread of the mean standard deviation for the precursor/peptide. For method = "noise", MNAR missingness is sampled from a normal distribution around the mean noise for the precursor/peptide and that has a spread of the mean standard deviation (from each condition) for the precursor/peptide. Both methods impute MAR data using the mean and variance of the condition with the missing data.

skip_log2_transform_error

a logical value that determines if a check is performed to validate that input values are log2 transformed. If input values are > 40 the test is failed and an error is returned.

retain_columns

a vector that indicates columns that should be retained from the input data frame. Default is not retaining additional columns retain_columns = NULL. Specific columns can be retained by providing their names (not in quotations marks, just like other column names, but in a vector).

Value

A data frame that contains an imputed_intensity and imputed column in addition to the required input columns. The imputed column indicates if a value was imputed. The imputed_intensity column contains imputed intensity values for previously missing intensities.

Examples

set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 10,
  frac_change = 0.5,
  n_replicates = 4,
  n_conditions = 2,
  method = "effect_random",
  additional_metadata = FALSE
)

head(data, n = 24)

# Assign missingness information
data_missing <- assign_missingness(
  data,
  sample = sample,
  condition = condition,
  grouping = peptide,
  intensity = peptide_intensity_missing,
  ref_condition = "all",
  retain_columns = c(protein, peptide_intensity)
)

head(data_missing, n = 24)

# Perform imputation
data_imputed <- impute(
  data_missing,
  sample = sample,
  grouping = peptide,
  intensity_log2 = peptide_intensity_missing,
  condition = condition,
  comparison = comparison,
  missingness = missingness,
  method = "ludovic",
  retain_columns = c(protein, peptide_intensity)
)

head(data_imputed, n = 24)

Imputation of Missing Values Using Random Forest Imputation

Description

impute_randomforest performs imputation for missing values in the data using the random forest-based method implemented in the missForest package.

Usage

impute_randomforest(
  data,
  sample,
  grouping,
  intensity_log2,
  retain_columns = NULL,
  ...
)

Arguments

data

A data frame that contains the input variables. This should include columns for the sample names, precursor or peptide identifiers, and intensity values.

sample

A character column in the data data frame that contains the sample names.

grouping

A character column in the data data frame that contains the precursor or peptide identifiers.

intensity_log2

A numeric column in the data data frame that contains the intensity values.

retain_columns

A character vector indicating which columns should be retained from the input data frame. These columns will be preserved in the output alongside the imputed values. By default, no additional columns are retained (retain_columns = NULL), but specific columns can be retained by providing their names as a vector.

...

Additional parameters to pass to the missForest function. These parameters can control aspects such as the number of trees (ntree) and the stopping criteria (maxiter).

Details

The function imputes missing values by building random forests, where missing values are predicted based on other available values within the dataset. For each variable with missing data, the function trains a random forest model using the available (non-missing) data in that variable, and subsequently predicts the missing values.

In addition to the imputed values, users can choose to retain additional columns from the original input data frame that were not part of the imputation process.

This function allows passing additional parameters to the underlying missForest function, such as controlling the number of trees used in the random forest models or specifying the stopping criteria. For a full list of parameters, refer to the missForest documentation.

To enable parallelisation, ensure that the doParallel package is installed and loaded:

install.packages("doParallel")
library(doParallel)

Then register the desired number of cores for parallel processing:

registerDoParallel(cores = 6)

To leverage parallelisation during the imputation, pass parallelize = "variables" as an argument to the missForest function.

Value

A data frame that contains an imputed_intensity column with the imputed values and an imputed column indicating whether each value was imputed (TRUE) or not (FALSE), in addition to any columns retained via retain_columns.

Author(s)

Elena Krismer

References

Stekhoven, D.J., & Bühlmann, P. (2012). MissForest—non-parametric missing value imputation for mixed-type data. Bioinformatics, 28(1), 112-118. https://doi.org/10.1093/bioinformatics/btr597

Examples

set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 10,
  frac_change = 0.5,
  n_replicates = 4,
  n_conditions = 2,
  method = "effect_random",
  additional_metadata = FALSE
)

head(data, n = 24)

# Perform imputation
data_imputed <- impute_randomforest(
  data,
  sample = sample,
  grouping = peptide,
  intensity_log2 = peptide_intensity_missing
)

head(data_imputed, n = 24)

Perform KEGG pathway enrichment analysis

Description

[Deprecated] This function was deprecated due to its name changing to calculate_kegg_enrichment().

Usage

kegg_enrichment(...)

Value

A bar plot displaying negative log10 adjusted p-values for the top 10 enriched pathways. Bars are coloured according to the direction of the enrichment. If plot = FALSE, a data frame is returned.


Viridis colour scheme

Description

A perceptually uniform colour scheme originally created for the Seaborn python package.

Usage

mako_colours

Format

A vector containing 256 colours

Source

created for the Seaborn statistical data visualization package for Python


Maps peptides onto a PDB structure or AlphaFold prediction

Description

Peptides are mapped onto PDB structures or AlphaFold prediction based on their positions. This is accomplished by replacing the B-factor information in the structure file with values that allow highlighting of peptides, protein regions or amino acids when the structure is coloured by B-factor. In addition to simply highlighting peptides, protein regions or amino acids, a continuous variable such as fold changes associated with them can be mapped onto the structure as a colour gradient.

Usage

map_peptides_on_structure(
  peptide_data,
  uniprot_id,
  pdb_id,
  chain,
  auth_seq_id,
  map_value,
  baseline_map_value = NULL,
  file_format = ".cif",
  alphafold_version = "v6",
  scale_per_structure = TRUE,
  export_location = NULL,
  structure_file = NULL,
  show_progress = TRUE
)

Arguments

peptide_data

a data frame that contains the input columns to this function. If structure or prediction files should be fetched automatically, please provide column names to the following arguments: uniprot_id, pdb_id, chain, auth_seq_id, map_value. If no PDB structure for a protein is available the pdb_id and chain column should contain NA at these positions. If a structure or prediction file is provided in the structure_file argument, this data frame should only contain information associated with the provided structure. In case of a user provided structure, column names should be provided to the following arguments: uniprot_id, chain, auth_seq_id, map_value.

uniprot_id

a character column in the peptide_data data frame that contains UniProt identifiers for a corresponding peptide, protein region or amino acid.

pdb_id

a character column in the peptide_data data frame that contains PDB identifiers for structures in which a corresponding peptide, protein region or amino acid is found. If a protein prediction should be fetched from AlphaFold, this column should contain NA. This column is not required if a structure or prediction file is provided in the structure_file argument.

chain

a character column in the peptide_data data frame that contains the name of the chain from the PDB structure in which the peptide, protein region or amino acid is found. If a protein prediction should be fetched from AlphaFold, this column should contain NA. If an AlphaFold prediction is provided to the structure_file argument the chain should be provided as usual (All AlphaFold predictions only have chain A). Important: please provide the author defined chain definitions for both ".cif" and ".pdb" files. When the output of the find_peptide_in_structure function is used as the input for this function, this corresponds to the auth_asym_id column.

auth_seq_id

a character (or numeric) column in the peptide_data data frame that contains semicolon separated positions of peptides, protein regions or amino acids in the corresponding PDB structure or AlphaFold prediction. Can be NA for rows that should not be mapped. This information can be obtained from the find_peptide_in_structure function. The corresponding column in the output is called auth_seq_id. In case of AlphaFold predictions, UniProt positions should be used. If signal positions and not stretches of amino acids are provided, the column can be numeric and does not need to contain the semicolon separator.

map_value

a numeric column in the peptide_data data frame that contains a value associated with each peptide, protein region or amino acid. If one start to end position pair has multiple different map values, the maximum will be used. This value will be displayed as a colour gradient when mapped onto the structure. The value can for example be the fold change, p-value or score associated with each peptide, protein region or amino acid (selection). If the selections should be displayed with just one colour, the value in this column should be the same for every selection. For the mapping, values are scaled between 50 and 100. Regions in the structure that do not map any selection receive a value of 0. If an amino acid position is associated with multiple mapped values, e.g. from different peptides, the maximum mapped value will be displayed.

baseline_map_value

optional, a numeric value defining the baseline of the map_value. If, for a given structure or protein or the whole dataset (scale_per_structure = FALSE), all mapped values are equal to this baseline, the scaled values are set to 50, which is the lower bound of the scaling range. If not provided, constant values are scaled to 100, which is the upper bound.

file_format

a character vector containing the file format of the structure that will be fetched from the database for the PDB identifiers provided in the pdb_id column. This can be either ".cif" or ".pdb". The default is ".cif". We recommend using ".cif" files since every structure contains a ".cif" file but not every structure contains a ".pdb" file. Fetching and mapping onto ".cif" files takes longer than for ".pdb" files. If a structure file is provided in the structure_file argument, the file format is detected automatically and does not need to be provided.

alphafold_version

a character value that specifies the alphafold version that should be used. This is regularly updated by the database. We always try to make the current version the default version. Available version can be found here: https://ftp.ebi.ac.uk/pub/databases/alphafold/

scale_per_structure

a logical value that specifies if scaling should be performed for each structure independently (TRUE) or over the whole data set (FALSE). The default is TRUE, which scales the scores of each structure independently so that each structure has a score range from 50 to 100.

export_location

optional, a character argument specifying the path to the location in which the fetched and altered structure files should be saved. If left empty, they will be saved in the current working directory. The location should be provided in the following format "folderA/folderB".

structure_file

optional, a character argument specifying the path to the location and name of a structure file in ".cif" or ".pdb" format. If a structure is provided the peptide_data data frame should only contain mapping information for this structure.

show_progress

a logical, if show_progress = TRUE, a progress bar will be shown (default is TRUE).

Value

The function exports a modified ".pdb" or ".cif" structure file. B-factors have been replaced with scaled (50-100) values provided in the map_value column.

Examples



# Load libraries
library(dplyr)

# Create example data
peptide_data <- data.frame(
  uniprot_id = c("P0A8T7", "P0A8T7", "P60906"),
  peptide_sequence = c(
    "SGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNV",
    "NVFEGERVER",
    "AIGEVTDVVEKE"
  ),
  start = c(1160, 1197, 55),
  end = c(1198, 1206, 66),
  map_value = c(70, 100, 100)
)

# Find peptide positions in structures
positions_structure <- find_peptide_in_structure(
  peptide_data = peptide_data,
  peptide = peptide_sequence,
  start = start,
  end = end,
  uniprot_id = uniprot_id,
  retain_columns = c(map_value)) %>%
  filter(pdb_ids %in% c("6UU2", "2EL9"))

# Map peptides on structures
# You can determine the preferred output location
# with the export_location argument. Currently it
# is saved in the working directory.
map_peptides_on_structure(
  peptide_data = positions_structure,
  uniprot_id = uniprot_id,
  pdb_id = pdb_ids,
  chain = auth_asym_id,
  auth_seq_id = auth_seq_id,
  map_value = map_value,
  file_format = ".pdb",
  export_location = getwd()
)




Intensity normalisation

Description

[Deprecated] This function was deprecated due to its name changing to normalise(). The normalisation method in the new function needs to be provided as an argument.

Usage

median_normalisation(...)

Value

A data frame with a column called normalised_intensity_log2 containing the normalised intensity values.


List of metal-related ChEBI IDs in UniProt

Description

A list that contains all ChEBI IDs that appear in UniProt and that contain either a metal atom in their formula or that do not have a formula but the ChEBI term is related to metals. This was last updated on the 08/08/24.

Usage

metal_chebi_uniprot

Format

A data.frame containing information retrieved from ChEBI using fetch_chebi(stars = c(2, 3)), filtered using symbols in the metal_list and manual annotation of metal related ChEBI IDs that do not contain a formula.

Source

UniProt (cc_cofactor, cc_catalytic_activity, ft_binding) and ChEBI


Molecular function gene ontology metal subset

Description

A subset of molecular function gene ontology terms related to metals that was created using the slimming process provided by the QuickGO EBI database. This was last updated on the 19/02/24.

Usage

metal_go_slim_subset

Format

A data.frame containing a slim subset of molecular function gene ontology terms that are related to metal binding. The slims_from_id column contains all IDs relevant in this subset while the slims_to_ids column contains the starting IDs. If ChEBI IDs have been annotated manually this is indicated in the database column.

Source

QuickGO and ChEBI


List of metals

Description

A list of all metals and metalloids in the periodic table.

Usage

metal_list

Format

A data.frame containing the columns atomic_number, symbol, name, type, chebi_id, chebi_ion_id.

Source

https://en.wikipedia.org/wiki/Metal and https://en.wikipedia.org/wiki/Metalloid


Analyse protein interaction network for significant hits

Description

[Deprecated] This function was deprecated due to its name changing to analyse_functional_network().

Usage

network_analysis(...)

Value

A network plot displaying interactions of the provided proteins. If binds_treatment was provided halos around the proteins show which proteins interact with the treatment. If plot = FALSE a data frame with interaction information is returned.


Intensity normalisation

Description

Performs normalisation on intensities. For median normalisation the normalised intensity is the original intensity minus the run median plus the global median. This is also the way it is implemented in the Spectronaut search engine.

Usage

normalise(data, sample, intensity_log2, method = "median")

Arguments

data

a data frame containing at least sample names and intensity values. Please note that if the data frame is grouped, the normalisation will be computed by group.

sample

a character column in the data data frame that contains the sample names.

intensity_log2

a numeric column in the data data frame that contains the log2 transformed intensity values to be normalised.

method

a character value specifying the method to be used for normalisation. Default is "median".

Value

A data frame with a column called normalised_intensity_log2 containing the normalised intensity values.

Examples

data <- data.frame(
  r_file_name = c("s1", "s2", "s3", "s1", "s2", "s3"),
  intensity_log2 = c(18, 19, 17, 20, 21, 19)
)

normalise(data,
  sample = r_file_name,
  intensity_log2 = intensity_log2,
  method = "median"
)

Creates a contact map of all atoms from a structure file (using parallel processing)

Description

This function is a wrapper around create_structure_contact_map() that allows the use of all system cores for the creation of contact maps. Alternatively, it can be used for sequential processing of large datasets. The benefit of this function over create_structure_contact_map() is that it processes contact maps in batches, which is recommended for large datasets. If used for parallel processing it should only be used on systems that have enough memory available. Workers can either be set up manually before running the function with future::plan(multisession) or automatically by the function (maximum number of workers is 12 in this case). If workers are set up manually the processing_type argument should be set to "parallel manual". In this case workers can be terminated after completion with future::plan(sequential).

Usage

parallel_create_structure_contact_map(
  data,
  data2 = NULL,
  id,
  chain = NULL,
  auth_seq_id = NULL,
  distance_cutoff = 10,
  pdb_model_number_selection = c(0, 1),
  return_min_residue_distance = TRUE,
  export = FALSE,
  export_location = NULL,
  split_n = 40,
  processing_type = "parallel"
)

Arguments

data

a data frame containing at least a column with PDB ID information of which the name can be provided to the id argument. If only this column is provided, all atom or residue distances are calculated. Additionally, a chain column can be present in the data frame of which the name can be provided to the chain argument. If chains are provided, only distances of this chain relative to the rest of the structure are calculated. Multiple chains can be provided in multiple rows. If chains are provided for one structure but not for another, the rows should contain NAs. Furthermore, specific residue positions can be provided in the auth_seq_id column if the selection should be further reduced. It is not recommended to create full contact maps for more than a few structures due to time and memory limitations. If contact maps are created only for small regions it is possible to create multiple maps at once. By default distances of regions provided in this data frame to the complete structure are computed. If distances of regions from this data frame to another specific subset of regions should be computed, the second subset of regions can be provided through the optional data2 argument.

data2

optional, a data frame that contains a subset of regions for which distances to regions provided in the data data frame should be computed. If regions from the data data frame should be compared to the whole structure, data2 does not need to be provided. This data frame should have the same structure and column names as the data data frame.

id

a character column in the data data frame that contains PDB or UniProt IDs for structures or AlphaFold predictions of which contact maps should be created. If a structure not downloaded directly from PDB is provided (i.e. a locally stored structure file) to the structure_file argument, this column should contain "my_structure" as content.

chain

optional, a character column in the data data frame that contains chain identifiers for the structure file. Identifiers defined by the structure author should be used. Distances will be only calculated between the provided chains and the rest of the structure.

auth_seq_id

optional, a character (or numeric) column in the data data frame that contains semicolon separated positions of regions for which distances should be calculated. This always needs to be provided in combination with a corresponding chain in chain. The position should match the positioning defined by the structure author. For PDB structures this information can be obtained from the find_peptide_in_structure function. The corresponding column in the output is called auth_seq_id. If an AlphaFold prediction is provided, UniProt positions should be used. If single positions and not stretches of amino acids are provided, the column can be numeric and does not need to contain the semicolon separator.

distance_cutoff

a numeric value specifying the distance cutoff in Angstrom. All values for pairwise comparisons are calculated but only values smaller than this cutoff will be returned in the output. If a cutoff of e.g. 5 is selected then only residues with a distance of 5 Angstrom and less are returned. Using a small value can reduce the size of the contact map drastically and is therefore recommended. The default value is 10.

pdb_model_number_selection

a numeric vector specifying which models from the structure files should be considered for contact maps. E.g. NMR models often have many models in one file. The default for this argument is c(0, 1). This means the first model of each structure file is selected for contact map calculations. For AlphaFold predictions the model number is 0 (only .pdb files), therefore this case is also included here.

return_min_residue_distance

a logical value that specifies if the contact map should be returned for all atom distances or the minimum residue distances. Minimum residue distances are smaller in size. If atom distances are not strictly needed it is recommended to set this argument to TRUE. The default is TRUE.

export

a logical value that indicates if contact maps should be exported as ".csv". The name of the file will be the structure ID. Default is export = FALSE.

export_location

optional, a character value that specifies the path to the location in which the contact map should be saved if export = TRUE. If left empty, they will be saved in the current working directory. The location should be provided in the following format "folderA/folderB".

split_n

a numeric value that specifies the number of structures that should be included in each batch. Default is 40.

processing_type

a character value that is either "parallel" for parallel processing or "sequential" for sequential processing. Alternatively it can also be "parallel manual" in this case you have to set up the number of cores on your own using the future::plan(multisession) function. The default is "parallel".

Value

A list of contact maps for each PDB or UniProt ID provided in the input is returned. If the export argument is TRUE, each contact map will be saved as a ".csv" file in the current working directory or the location provided to the export_location argument.

Examples

## Not run: 
# Create example data
data <- data.frame(
  pdb_id = c("6NPF", "1C14", "3NIR"),
  chain = c("A", "A", NA),
  auth_seq_id = c("1;2;3;4;5;6;7", NA, NA)
)

# Create contact map
contact_maps <- parallel_create_structure_contact_map(
  data = data,
  id = pdb_id,
  chain = chain,
  auth_seq_id = auth_seq_id,
  split_n = 1,
)

str(contact_maps[["3NIR"]])

contact_maps

## End(Not run)

Fitting four-parameter dose response curves (using parallel processing)

Description

This function is a wrapper around fit_drc_4p that allows the use of all system cores for model fitting. It should only be used on systems that have enough memory available. Workers can either be set up manually before running the function with future::plan(multisession) or automatically by the function (maximum number of workers is 12 in this case). If workers are set up manually the number of cores should be provided to n_cores. Worker can be terminated after completion with future::plan(sequential). It is not possible to export the individual fit objects when using this function as compared to the non parallel function as they are too large for efficient export from the workers.

Usage

parallel_fit_drc_4p(
  data,
  sample,
  grouping,
  response,
  dose,
  filter = "post",
  replicate_completeness = 0.7,
  condition_completeness = 0.5,
  n_replicate_completeness = NULL,
  n_condition_completeness = NULL,
  complete_doses = NULL,
  anova_cutoff = 0.05,
  correlation_cutoff = 0.8,
  log_logarithmic = TRUE,
  retain_columns = NULL,
  n_cores = NULL
)

Arguments

data

a data frame that contains at least the input variables.

sample

a character column in the data data frame that contains the sample names.

grouping

a character column in the data data frame that contains the precursor, peptide or protein identifiers.

response

a numeric column in the data data frame that contains the response values, e.g. log2 transformed intensities.

dose

a numeric column in the data data frame that contains the dose values, e.g. the treatment concentrations.

filter

a character value that can either be "pre", "post" or "none". The data is annotated for completeness, ANOVA significance and the completeness distribution along the doses ("pre" and "post"). The combined output of this filtering step can be found in the passed_filter column and depends on the cutoffs provided to the function. Note that this is only an annotation and nothing is removed from the output. If "pre" is selected then, in addition to the annotation, the data is filtered for completeness based on the condition completeness prior to the curve fitting and ANOVA calculation and p-value adjustment. This has the benefit that less curves need to be fitted and that the ANOVA p-value adjustment is done only on the relevant set of tests. If "none" is selected the data will be neither annotated nor filtered.

replicate_completeness

[Deprecated] please use n_replicate_completeness instead. A numeric value which similar to completenss_MAR of the assign_missingness function sets a threshold for the completeness of data. In contrast to assign_missingness it only determines the completeness for one condition and not the comparison of two conditions. The threshold is used to calculate a minimal degree of data completeness. The value provided to this argument has to be between 0 and 1, default is 0.7. It is multiplied with the number of replicates and then adjusted downward. The resulting number is the minimal number of observations that a condition needs to have to be considered "complete enough" for the condition_completeness argument.

condition_completeness

[Deprecated] please use n_condition_completeness instead. A numeric value which determines how many conditions need to at least fulfill the "complete enough" criteria set with replicate_completeness. The value provided to this argument has to be between 0 and 1, default is 0.5. It is multiplied with the number of conditions and then adjusted downward. The resulting number is the minimal number of conditions that need to fulfill the replicate_completeness argument for a peptide to pass the filtering.

n_replicate_completeness

a numeric value that defines the minimal number of observations that a condition (concentration) needs to have to be considered "complete enough" for the n_condition_completeness argument. E.g. if each concentration has 4 replicates this argument could be set to 3 to allow for one replicate to be missing for the completeness criteria.

n_condition_completeness

a numeric value that defines the minimal number of conditions that need to fulfill the n_replicate_completeness argument for a feature to pass the filtering. E.g. if an experiment has 12 concentrations, this argument could be set to 6 to define that at least 6 of 12 concentrations need to make the replicate completeness cutoff.

complete_doses

an optional numeric vector that supplies all the actually used doses (concentrations) to the function. Usually the function extracts this information from the supplied data. However, for incomplete datasets the total number of assumed doses might be wrong. This might especially affect parallel fitting of curves since the dataset is split up into smaller pieces. Therefore, it becomes important to provide this argument especially when the dataset is small and potentially incomplete. This information is only used for the missing not at random (MNAR) estimations.

anova_cutoff

a numeric value that specifies the ANOVA adjusted p-value cutoff used for data filtering. Any fits with an adjusted ANOVA p-value bellow the cutoff will be considered for scoring. The default is 0.05.

correlation_cutoff

a numeric value that specifies the correlation cutoff used for data filtering. Any fits with a correlation above the cutoff will be considered for scoring.

log_logarithmic

a logical value that indicates if a logarithmic or log-logarithmic model is fitted. If response values form a symmetric curve for non-log transformed dose values, a logarithmic model instead of a log-logarithmic model should be used. Usually biological dose response data has a log-logarithmic distribution, which is the reason this is the default. Log-logarithmic models are symmetric if dose values are log transformed.

retain_columns

a vector that specifies columns that should be retained from the input data frame. Default is not retaining additional columns retain_columns = NULL. Specific columns can be retained by providing their names (not in quotations marks, just like other column names, but in a vector).

n_cores

optional, a numeric value that specifies the number of cores used if workers are set up manually.

Details

If data filtering options are selected, data is annotated based on multiple criteria. If "post" is selected the data is annotated based on completeness, the completeness distribution, the adjusted ANOVA p-value cutoff and a correlation cutoff. Completeness of features is determined based on the n_replicate_completeness and n_condition_completeness arguments. The completeness distribution determines if there is a distribution of not random missingness of data along the dose. For this it is checked if half of a features values (+/-1 value) pass the replicate completeness criteria and half do not pass it. In order to fall into this category, the values that fulfill the completeness cutoff and the ones that do not fulfill it need to be consecutive, meaning located next to each other based on their concentration values. Furthermore, the values that do not pass the completeness cutoff need to be lower in intensity. Lastly, the difference between the two groups is tested for statistical significance using a Welch's t-test and a cutoff of p <= 0.1 (we want to mainly discard curves that falsely fit the other criteria but that have clearly non-significant differences in mean). This allows curves to be considered that have missing values in half of their observations due to a decrease in intensity. It can be thought of as conditions that are missing not at random (MNAR). It is often the case that those entities do not have a significant p-value since half of their conditions are not considered due to data missingness. The ANOVA test is performed on the features by concentration. If it is significant it is likely that there is some response. However, this test would also be significant even if there is one outlier concentration so it should only be used only in combination with other cutoffs to determine if a feature is significant. The passed_filter column is TRUE for all the features that pass the above mentioned criteria and that have a correlation greater than the cutoff (default is 0.8) and the adjusted ANOVA p-value below the cutoff (default is 0.05).

The final list is ranked based on a score calculated on entities that pass the filter. The score is the negative log10 of the adjusted ANOVA p-value scaled between 0 and 1 and the correlation scaled between 0 and 1 summed up and divided by 2. Thus, the highest score an entity can have is 1 with both the highest correlation and adjusted p-value. The rank is corresponding to this score. Please note, that entities with MNAR conditions might have a lower score due to the missing or non-significant ANOVA p-value. If no score could be calculated the usual way these cases receive a score of 0. You should have a look at curves that are TRUE for dose_MNAR in more detail.

If the "pre" option is selected for the filter argument then the data is filtered for completeness prior to curve fitting and the ANOVA test. Otherwise annotation is performed exactly as mentioned above. We recommend the "pre" option because it leaves you with not only the likely hits of your treatment, but also with rather high confidence true negative results. This is because the filtered data has a high degree of completeness making it unlikely that a real dose-response curve is missed due to data missingness.

Please note that in general, curves are only fitted if there are at least 5 conditions with data points present to ensure that there is potential for a good curve fit. This is done independent of the selected filtering option.

Value

A data frame is returned that contains correlations of predicted to measured values as a measure of the goodness of the curve fit, an associated p-value and the four parameters of the model for each group. Furthermore, input data for plots is returned in the columns plot_curve (curve and confidence interval) and plot_points (measured points).

Examples

## Not run: 
# Load libraries
library(dplyr)

set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 2,
  frac_change = 1,
  n_replicates = 3,
  n_conditions = 8,
  method = "dose_response",
  concentrations = c(0, 1, 10, 50, 100, 500, 1000, 5000),
  additional_metadata = FALSE
)

# Perform dose response curve fit
drc_fit <- parallel_fit_drc_4p(
  data = data,
  sample = sample,
  grouping = peptide,
  response = peptide_intensity_missing,
  dose = concentration,
  n_replicate_completeness = 2,
  n_condition_completeness = 5,
  retain_columns = c(protein, change_peptide)
)

glimpse(drc_fit)

head(drc_fit, n = 10)

## End(Not run)

Peptide abundance profile plot

Description

Creates a plot of peptide abundances across samples. This is helpful to investigate effects of peptide and protein abundance changes in different samples and conditions.

Usage

peptide_profile_plot(
  data,
  sample,
  peptide,
  intensity_log2,
  grouping,
  targets,
  complete_sample = FALSE,
  protein_abundance_plot = FALSE,
  interactive = FALSE,
  export = FALSE,
  export_name = "peptide_profile_plots"
)

Arguments

data

a data frame that contains at least the input variables.

sample

a character column in the data data frame that contains sample names.

peptide

a character column in the data data frame that contains peptide or precursor names.

intensity_log2

a numeric column in the data data frame that contains log2 transformed intensities.

grouping

a character column in the data data frame that contains groups by which the data should be split. This can be for example protein IDs.

targets

a character vector that specifies elements of the grouping column which should be plotted. This can also be "all" if plots for all groups should be created. Depending on the number of elements in your grouping column this can be many plots.

complete_sample

a logical value that indicates if samples that are completely missing for a given protein should be shown on the x-axis of the plot anyway. The default value is FALSE.

protein_abundance_plot

a logical value. If the input for this plot comes directly from calculate_protein_abundance this argument can be set to TRUE. This displays all peptides in gray, while the protein abundance is displayed in green.

interactive

a logical value that indicates whether the plot should be interactive (default is FALSE). If this is TRUE only one target can be supplied to the function. Interactive plots cannot be exported either.

export

a logical value that indicates if plots should be exported as PDF. The output directory will be the current working directory. The name of the file can be chosen using the export_name argument.

export_name

a character vector that provides the name of the exported file if export = TRUE.

Value

A list of peptide profile plots.

Examples


# Create example data
data <- data.frame(
  sample = c(
    rep("S1", 6),
    rep("S2", 6),
    rep("S1", 2),
    rep("S2", 2)
  ),
  protein_id = c(
    rep("P1", 12),
    rep("P2", 4)
  ),
  precursor = c(
    rep(c("A1", "A2", "B1", "B2", "C1", "D1"), 2),
    rep(c("E1", "F1"), 2)
  ),
  peptide = c(
    rep(c("A", "A", "B", "B", "C", "D"), 2),
    rep(c("E", "F"), 2)
  ),
  intensity = c(
    rnorm(n = 6, mean = 15, sd = 2),
    rnorm(n = 6, mean = 21, sd = 1),
    rnorm(n = 2, mean = 15, sd = 1),
    rnorm(n = 2, mean = 15, sd = 2)
  )
)

# Calculate protein abundances and retain precursor
# abundances that can be used in a peptide profile plot
complete_abundances <- calculate_protein_abundance(
  data,
  sample = sample,
  protein_id = protein_id,
  precursor = precursor,
  peptide = peptide,
  intensity_log2 = intensity,
  method = "sum",
  for_plot = TRUE
)

# Plot protein abundance profile
# protein_abundance_plot can be set to
# FALSE to to also colour precursors
peptide_profile_plot(
  data = complete_abundances,
  sample = sample,
  peptide = precursor,
  intensity_log2 = intensity,
  grouping = protein_id,
  targets = c("P1"),
  protein_abundance_plot = TRUE
)


Assign peptide type

Description

[Deprecated] This function was deprecated due to its name changing to assign_peptide_type().

Usage

peptide_type(...)

Value

A data frame that contains the input data and an additional column with the peptide type information.


Perform gene ontology enrichment analysis

Description

[Deprecated] This function was deprecated due to its name changing to drc_4p_plot().

Usage

plot_drc_4p(...)

Value

If targets = "all" a list containing plots for every unique identifier in the grouping variable is created. Otherwise a plot for the specified targets is created with maximally 20 facets.


Peptide abundance profile plot

Description

[Deprecated] This function was deprecated due to its name changing to peptide_profile_plot().

Usage

plot_peptide_profiles(...)

Value

A list of peptide profile plots.


Plot histogram of p-value distribution

Description

[Deprecated] This function was deprecated due to its name changing to pval_distribution_plot().

Usage

plot_pval_distribution(...)

Value

A histogram plot that shows the p-value distribution.


Predict protein domains of AlphaFold predictions

Description

Uses the predicted aligned error (PAE) of AlphaFold predictions to find possible protein domains. A graph-based community clustering algorithm (Leiden clustering) is used on the predicted error (distance) between residues of a protein in order to infer pseudo-rigid groups in the protein. This is for example useful in order to know which parts of protein predictions are likely in a fixed relative position towards each other and which might have varying distances. This function is based on python code written by Tristan Croll. The original code can be found on his GitHub page.

Usage

predict_alphafold_domain(
  pae_list,
  pae_power = 1,
  pae_cutoff = 5,
  graph_resolution = 1,
  return_data_frame = FALSE,
  show_progress = TRUE
)

Arguments

pae_list

a list of proteins that contains aligned errors for their AlphaFold predictions. This list can be retrieved with the fetch_alphafold_aligned_error() function. It should contain a column containing the scored residue (scored_residue), the aligned residue (aligned_residue) and the predicted aligned error (error).

pae_power

a numeric value, each edge in the graph will be weighted proportional to (1 / pae^pae_power). Default is 1.

pae_cutoff

a numeric value, graph edges will only be created for residue pairs with pae < pae_cutoff. Default is 5.

graph_resolution

a numeric value that regulates how aggressive the clustering algorithm is. Smaller values lead to larger clusters. Value should be larger than zero, and values larger than 5 are unlikely to be useful. Higher values lead to stricter (i.e. smaller) clusters. The value is provided to the Leiden clustering algorithm of the igraph package as graph_resolution / 100. Default is 1.

return_data_frame

a logical value; if TRUE a data frame instead of a list is returned. It is recommended to only use this if information for few proteins is retrieved. Default is FALSE.

show_progress

a logical value that specifies if a progress bar will be shown. Default is TRUE.

Value

A list of the provided proteins that contains domain assignments for each residue. If return_data_frame is TRUE, a data frame with this information is returned instead. The data frame contains the following columns:

Examples


# Fetch aligned errors
aligned_error <- fetch_alphafold_aligned_error(
  uniprot_ids = c("F4HVG8", "O15552"),
  error_cutoff = 4
)

# Predict protein domains
af_domains <- predict_alphafold_domain(
  pae_list = aligned_error,
  return_data_frame = TRUE
)

head(af_domains, n = 10)


Colour scheme for protti

Description

A colour scheme for protti that contains 100 colours.

Usage

protti_colours

Format

A vector containing 100 colours

Source

Dina's imagination.


Structural analysis example data

Description

Example data used for the vignette about structural analysis. The data was obtained from Cappelletti et al. 2021 (doi:10.1016/j.cell.2020.12.021) and corresponds to two separate experiments. Both experiments were limited proteolyis coupled to mass spectrometry (LiP-MS) experiments conducted on purified proteins. The first protein is phosphoglycerate kinase 1 (pgk) and it was treated with 25mM 3-phosphoglyceric acid (3PG). The second protein is phosphoenolpyruvate-protein phosphotransferase (ptsI) and it was treated with 25mM fructose 1,6-bisphosphatase (FBP). From both experiments only peptides belonging to either protein were used for this data set. The ptsI data set contains precursor level data while the pgk data set contains peptide level data. The pgk data can be obtained from supplementary table 3 from the tab named "pgk+3PG". The ptsI data is only included as raw data and was analysed using the functions of this package.

Usage

ptsi_pgk

Format

A data frame containing differential abundances and adjusted p-values for peptides/precursors of two proteins.

Source

Cappelletti V, Hauser T, Piazza I, Pepelnjak M, Malinovska L, Fuhrer T, Li Y, Dörig C, Boersema P, Gillet L, Grossbach J, Dugourd A, Saez-Rodriguez J, Beyer A, Zamboni N, Caflisch A, de Souza N, Picotti P. Dynamic 3D proteomes reveal protein functional alterations at high resolution in situ. Cell. 2021 Jan 21;184(2):545-559.e22. doi:10.1016/j.cell.2020.12.021. Epub 2020 Dec 23. PMID: 33357446; PMCID: PMC7836100.


Plot histogram of p-value distribution

Description

Plots the distribution of p-values derived from any statistical test as a histogram.

Usage

pval_distribution_plot(data, grouping, pval, facet_by = NULL)

Arguments

data

a data frame that contains at least grouping identifiers (precursor, peptide or protein) and p-values derived from any statistical test.

grouping

a character column in the data data frame that contains either precursor, peptide or protein identifiers. For each entry in this column there should be one unique p-value. That means the statistical test that created the p-value should have been performed on the level of the content of this column.

pval

a numeric column in the data data frame that contains p-values.

facet_by

optional, a character column that contains information by which the data should be faceted into multiple plots.

Value

A histogram plot that shows the p-value distribution.

Examples

set.seed(123) # Makes example reproducible

# Create example data
data <- data.frame(
  peptide = paste0("peptide", 1:1000),
  pval = runif(n = 1000)
)

# Plot p-values
pval_distribution_plot(
  data = data,
  grouping = peptide,
  pval = pval
)

Check charge state distribution

Description

Calculates the charge state distribution for each sample (by count or intensity).

Usage

qc_charge_states(
  data,
  sample,
  grouping,
  charge_states,
  intensity = NULL,
  remove_na_intensities = TRUE,
  method = "count",
  plot = FALSE,
  interactive = FALSE
)

Arguments

data

a data frame that contains at least sample names, peptide or precursor identifiers and missed cleavage counts for each peptide or precursor.

sample

a character or factor column in the data data frame that contains the sample name.

grouping

a character column in the data data frame that contains either precursor or peptide identifiers.

charge_states

a character or numeric column in the data data frame that contains the different charge states assigned to the precursor or peptide.

intensity

a numeric column in the data data frame that contains the corresponding raw or normalised intensity values (not log2) for each peptide or precursor. Required when "intensity" is chosen as the method.

remove_na_intensities

a logical value that specifies if sample/grouping combinations with intensities that are NA (not quantified IDs) should be dropped from the data frame for analysis of missed cleavages. Default is TRUE since we are usually interested in quantifiable peptides. This is only relevant for method = "count".

method

a character value that indicates the method used for evaluation. "count" calculates the charge state distribution based on counts of the corresponding peptides or precursors in the charge state group, "intensity" calculates the percentage of precursors or peptides in each charge state group based on the corresponding intensity values.

plot

a logical value that indicates whether the result should be plotted.

interactive

a logical value that specifies whether the plot should be interactive (default is FALSE).

Value

A data frame that contains the calculated percentage made up by the sum of either all counts or intensities of peptides or precursors of the corresponding charge state (depending on which method is chosen).

Examples

# Load libraries
library(dplyr)

set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 100,
  frac_change = 0.05,
  n_replicates = 3,
  n_conditions = 2,
  method = "effect_random"
) %>%
  mutate(intensity_non_log2 = 2^peptide_intensity_missing)

# Calculate charge percentages
qc_charge_states(
  data = data,
  sample = sample,
  grouping = peptide,
  charge_states = charge,
  intensity = intensity_non_log2,
  method = "intensity",
  plot = FALSE
)

# Plot charge states
qc_charge_states(
  data = data,
  sample = sample,
  grouping = peptide,
  charge_states = charge,
  intensity = intensity_non_log2,
  method = "intensity",
  plot = TRUE
)

Percentage of contaminants per sample

Description

Calculates the percentage of contaminating proteins as the share of total intensity.

Usage

qc_contaminants(
  data,
  sample,
  protein,
  is_contaminant,
  intensity,
  n_contaminants = 5,
  plot = TRUE,
  interactive = FALSE
)

Arguments

data

a data frame that contains at least the input variables.

sample

a character or factor column in the data data frame that contains the sample names.

protein

a character column in the data data frame that contains protein IDs or protein names.

is_contaminant

a logical column that indicates if the protein is a contaminant.

intensity

a numeric column in the data data frame that contains the corresponding raw or normalised intensity values (not log2).

n_contaminants

a numeric value that indicates how many contaminants should be displayed individually. The rest is combined to a group called "other". The default is 5.

plot

a logical value that indicates if a plot is returned. If FALSE a table is returned.

interactive

a logical value that indicates if the plot is made interactive using the r package plotly.

Value

A bar plot that displays the percentage of contaminating proteins over all samples. If plot = FALSE a data frame is returned.

Examples

data <- data.frame(
  sample = c(rep("sample_1", 10), rep("sample_2", 10)),
  leading_razor_protein = c(rep(c("P1", "P1", "P1", "P2", "P2", "P2", "P2", "P3", "P3", "P3"), 2)),
  potential_contaminant = c(rep(c(rep(TRUE, 7), rep(FALSE, 3)), 2)),
  intensity = c(rep(1, 2), rep(4, 4), rep(6, 4), rep(2, 3), rep(3, 5), rep(4, 2))
)

qc_contaminants(
  data,
  sample = sample,
  protein = leading_razor_protein,
  is_contaminant = potential_contaminant,
  intensity = intensity
)

Check CV distribution

Description

Calculates and plots the coefficients of variation for the selected grouping.

Usage

qc_cvs(
  data,
  grouping,
  condition,
  intensity,
  plot = TRUE,
  plot_style = "density",
  max_cv = 200
)

Arguments

data

a data frame containing at least peptide, precursor or protein identifiers, information on conditions and intensity values for each peptide, precursor or protein.

grouping

a character column in the data data frame that contains the grouping variables (e.g. peptides, precursors or proteins).

condition

a character or factor column in the data data frame that contains condition information (e.g. "treated" and "control").

intensity

a numeric column in the data data frame that contains the corresponding raw or untransformed normalised intensity values for each peptide or precursor.

plot

a logical value that indicates whether the result should be plotted.

plot_style

a character value that indicates the plotting style. plot_style = "boxplot" plots a boxplot, whereas plot_style = "density" plots the CV density distribution. plot_style = "violin" returns a violin plot. Default is plot_style = "density".

max_cv

a numeric value that specifies the maximum percentage of CVs that should be included in the returned plot. The default value is max_cv = 200.

Value

Either a data frame with the median CVs in % or a plot showing the distribution of the CVs is returned.

Examples

# Load libraries
library(dplyr)

set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 100,
  frac_change = 0.05,
  n_replicates = 3,
  n_conditions = 2,
  method = "effect_random"
) %>%
  mutate(intensity_non_log2 = 2^peptide_intensity_missing)

# Calculate coefficients of variation
qc_cvs(
  data = data,
  grouping = peptide,
  condition = condition,
  intensity = intensity_non_log2,
  plot = FALSE
)

# Plot coefficients of variation
# Different plot styles are available
qc_cvs(
  data = data,
  grouping = peptide,
  condition = condition,
  intensity = intensity_non_log2,
  plot = TRUE,
  plot_style = "violin"
)

Data completeness

Description

Calculates the percentage of data completeness. That means, what percentage of all detected precursors is present in each sample.

Usage

qc_data_completeness(
  data,
  sample,
  grouping,
  intensity,
  digestion = NULL,
  plot = TRUE,
  interactive = FALSE
)

Arguments

data

a data frame containing at least the input variables.

sample

a character or factor column in the data data frame that contains the sample names.

grouping

a character column in the data data frame that contains either precursor or peptide identifiers.

intensity

a numeric column in the data data frame that contains any intensity intensity values that missingness should be determined for.

digestion

optional, a character column in the data data frame that indicates the mode of digestion (limited proteolysis or tryptic digest). Alternatively, any other variable by which the data should be split can be provided.

plot

a logical value that indicates whether the result should be plotted.

interactive

a logical value that specifies whether the plot should be interactive (default is FALSE).

Value

A bar plot that displays the percentage of data completeness over all samples. If plot = FALSE a data frame is returned. If interactive = TRUE, the plot is interactive.

Examples

set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 100,
  frac_change = 0.05,
  n_replicates = 3,
  n_conditions = 2,
  method = "effect_random"
)

# Determine data completeness
qc_data_completeness(
  data = data,
  sample = sample,
  grouping = peptide,
  intensity = peptide_intensity_missing,
  plot = FALSE
)

# Plot data completeness
qc_data_completeness(
  data = data,
  sample = sample,
  grouping = peptide,
  intensity = peptide_intensity_missing,
  plot = TRUE
)

Check number of precursor, peptide or protein IDs

Description

Returns a plot or table of the number of IDs for each sample. The default settings remove grouping variables without quantitative information (intensity is NA). These will not be counted as IDs.

Usage

qc_ids(
  data,
  sample,
  grouping,
  intensity,
  remove_na_intensities = TRUE,
  condition = NULL,
  title = "ID count per sample",
  plot = TRUE,
  interactive = FALSE
)

Arguments

data

a data frame containing at least sample names and precursor/peptide/protein IDs.

sample

a character or factor column in the data data frame that contains the sample name.

grouping

a character column in the data data frame that contains either precursor or peptide identifiers.

intensity

a character column in the data data frame that contains raw or log2 transformed intensities. If remove_na_intensities = FALSE, this argument is optional.

remove_na_intensities

a logical value that specifies if sample/grouping combinations with intensities that are NA (not quantified IDs) should be dropped from the data frame. Default is TRUE since we are usually interested in the number of quantifiable IDs.

condition

optional, a column in the data data frame that contains condition information (e.g. "treated" and "control"). If this column is provided, the bars in the plot will be coloured according to the condition.

title

optional, a character value that specifies the plot title (default is "ID count per sample").

plot

a logical value that indicates whether the result should be plotted.

interactive

a logical value that specifies whether the plot should be interactive (default is FALSE).

Value

A bar plot with the height corresponding to the number of IDs, each bar represents one sample (if plot = TRUE). If plot = FALSE a table with ID counts is returned.

Examples

set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 100,
  frac_change = 0.05,
  n_replicates = 3,
  n_conditions = 2,
  method = "effect_random"
)

# Calculate number of identifications
qc_ids(
  data = data,
  sample = sample,
  grouping = peptide,
  intensity = peptide_intensity_missing,
  condition = condition,
  plot = FALSE
)

# Plot number of identifications
qc_ids(
  data = data,
  sample = sample,
  grouping = peptide,
  intensity = peptide_intensity_missing,
  condition = condition,
  plot = TRUE
)

Check intensity distribution per sample and overall

Description

Plots the overall or sample-wise distribution of all peptide intensities as a boxplot or histogram.

Usage

qc_intensity_distribution(
  data,
  sample = NULL,
  grouping,
  intensity_log2,
  plot_style
)

Arguments

data

a data frame that contains at least sample names, grouping identifiers (precursor, peptide or protein) and log2 transformed intensities for each grouping identifier.

sample

an optional character or factor column in the data data frame that contains the sample name. If the sample column is of type factor, the ordering is based on the factor levels. NOTE: If the overall distribution should be returned please do not provide the name of the sample column.

grouping

a character column in the data data frame that contains the grouping variables (e.g. peptides, precursors or proteins).

intensity_log2

a numeric column in the data data frame that contains the log2 transformed intensities of each grouping identifier sample combination.

plot_style

a character value that indicates the plot type. This can be either "histogram", "boxplot" or "violin". Plot style "boxplot" and "violin" can only be used if a sample column is provided.

Value

A histogram or boxplot that shows the intensity distribution over all samples or by sample.

Examples

set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 100,
  frac_change = 0.05,
  n_replicates = 3,
  n_conditions = 2,
  method = "effect_random"
)

# Plot intensity distribution
# The plot style can be changed
qc_intensity_distribution(
  data = data,
  sample = sample,
  grouping = peptide,
  intensity_log2 = peptide_intensity_missing,
  plot_style = "boxplot"
)

Median run intensities

Description

Median intensities per run are returned either as a plot or a table.

Usage

qc_median_intensities(
  data,
  sample,
  grouping,
  intensity,
  plot = TRUE,
  interactive = FALSE
)

Arguments

data

a data frame that contains at least the input variables.

sample

a character or factor column in the data data frame that contains the sample name.

grouping

a character column in the data data frame that contains either precursor or peptide identifiers.

intensity

a numeric column in the data data frame that contains intensity values. The intensity should be ideally log2 transformed, but also non-transformed values can be used.

plot

a logical value that indicates whether the result should be plotted.

interactive

a logical value that specifies whether the plot should be interactive (default is FALSE).

Value

A plot that displays median intensity over all samples. If plot = FALSE a data frame containing median intensities is returned.

Examples

set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 100,
  frac_change = 0.05,
  n_replicates = 3,
  n_conditions = 2,
  method = "effect_random"
)

# Calculate median intensities
qc_median_intensities(
  data = data,
  sample = sample,
  grouping = peptide,
  intensity = peptide_intensity_missing,
  plot = FALSE
)

# Plot median intensities
qc_median_intensities(
  data = data,
  sample = sample,
  grouping = peptide,
  intensity = peptide_intensity_missing,
  plot = TRUE
)

Check missed cleavages

Description

Calculates the percentage of missed cleavages for each sample (by count or intensity). The default settings remove grouping variables without quantitative information (intensity is NA). These will not be used for the calculation of missed cleavage percentages.

Usage

qc_missed_cleavages(
  data,
  sample,
  grouping,
  missed_cleavages,
  intensity,
  remove_na_intensities = TRUE,
  method = "count",
  plot = FALSE,
  interactive = FALSE
)

Arguments

data

a data frame containing at least sample names, peptide or precursor identifiers and missed cleavage counts for each peptide or precursor.

sample

a character or factor column in the data data frame that contains the sample name.

grouping

a character column in the data data frame that contains either precursor or peptide identifiers.

missed_cleavages

a numeric column in the data data frame that contains the counts of missed cleavages per peptide or precursor.

intensity

a numeric column in the data data frame that contains the corresponding raw or normalised intensity values (not log2) for each peptide or precursor. Required when "intensity" is chosen as the method.

remove_na_intensities

a logical value that specifies if sample/grouping combinations with intensities that are NA (not quantified IDs) should be dropped from the data frame for analysis of missed cleavages. Default is TRUE since we are usually interested in quantifiable peptides. This is only relevant for method = "count".

method

a character value that indicates the method used for evaluation. "count" calculates the percentage of missed cleavages based on counts of the corresponding peptide or precursor, "intensity" calculates the percentage of missed cleavages by intensity of the corresponding peptide or precursor.

plot

a logical value that indicates whether the result should be plotted.

interactive

a logical value that specifies whether the plot should be interactive (default is FALSE).

Value

A data frame that contains the calculated percentage made up by the sum of all peptides or precursors containing the corresponding amount of missed cleavages.

Examples

library(dplyr)

set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 100,
  frac_change = 0.05,
  n_replicates = 3,
  n_conditions = 2,
  method = "effect_random"
) %>%
  mutate(intensity_non_log2 = 2^peptide_intensity_missing)

# Calculate missed cleavage percentages
qc_missed_cleavages(
  data = data,
  sample = sample,
  grouping = peptide,
  missed_cleavages = n_missed_cleavage,
  intensity = intensity_non_log2,
  method = "intensity",
  plot = FALSE
)

# Plot missed cleavages
qc_missed_cleavages(
  data = data,
  sample = sample,
  grouping = peptide,
  missed_cleavages = n_missed_cleavage,
  intensity = intensity_non_log2,
  method = "intensity",
  plot = TRUE
)

Plot principal component analysis

Description

Plots a principal component analysis based on peptide or precursor intensities.

Usage

qc_pca(
  data,
  sample,
  grouping,
  intensity,
  condition,
  components = c("PC1", "PC2"),
  digestion = NULL,
  plot_style = "pca"
)

Arguments

data

a data frame that contains sample names, peptide or precursor identifiers, corresponding intensities and a condition column indicating e.g. the treatment.

sample

a character column in the data data frame that contains the sample name.

grouping

a character column in the data data frame that contains either precursor or peptide identifiers.

intensity

a numeric column in the data data frame that contains the corresponding intensity values for each peptide or precursor.

condition

a numeric or character column in the data data frame that contains condition information (e.g. "treated" and "control").

components

a character vector indicating the two components that should be displayed in the plot. By default these are PC1 and PC2. You can provide these using a character vector of the form c("PC1", "PC2").

digestion

optional, a character column in the data data frame that indicates the mode of digestion (limited proteolysis or tryptic digest). Alternatively, any other variable by which the data should be split can be provided.

plot_style

a character value that specifies what plot should be returned. If plot_style = "pca" is selected the two PCA components supplied with the components argument are plottet against each other. This is the default. plot_style = "scree" returns a scree plot that displays the variance explained by each principal component in percent. The scree is useful for checking if any other than the default first two components should be plotted.

Value

A principal component analysis plot showing PC1 and PC2. If plot_style = "scree", a scree plot for all dimensions is returned.

Examples

set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 100,
  frac_change = 0.05,
  n_replicates = 3,
  n_conditions = 2,
)

# Plot scree plot
qc_pca(
  data = data,
  sample = sample,
  grouping = peptide,
  intensity = peptide_intensity_missing,
  condition = condition,
  plot_style = "scree"
)

# Plot principal components
qc_pca(
  data = data,
  sample = sample,
  grouping = peptide,
  intensity = peptide_intensity_missing,
  condition = condition
)

Peak width over retention time

Description

Plots one minute binned median precursor elution peak width over retention time for each sample.

Usage

qc_peak_width(
  data,
  sample,
  intensity,
  retention_time,
  peak_width = NULL,
  retention_time_start = NULL,
  retention_time_end = NULL,
  remove_na_intensities = TRUE,
  interactive = FALSE
)

Arguments

data

a data frame containing at least sample names and protein IDs.

sample

a character column in the data data frame that contains the sample names.

intensity

a numeric column in the data data frame that contains intensities. If remove_na_intensities = FALSE, this argument is not required.

retention_time

a numeric column in the data data frame that contains retention times of precursors.

peak_width

a numeric column in the data data frame that contains peak width information. It is not required if retention_time_start and retention_time_end columns are provided.

retention_time_start

a numeric column in the data data frame that contains the start time of the precursor elution peak. It is not required if the peak_width column is provided.

retention_time_end

a numeric column in the data data frame that contains the end time of the precursor elution peak. It is not required if the peak_width column is provided.

remove_na_intensities

a logical value that specifies if sample/grouping combinations with intensities that are NA (not quantified IDs) should be dropped from the data frame. Default is TRUE since we are usually interested in the peak width of quantifiable data.

interactive

a logical value that specifies whether the plot should be interactive (default is FALSE).

Value

A line plot displaying one minute binned median precursor elution peak width over retention time for each sample.

Examples


data <- data.frame(
  r_file_name = c(rep("sample_1", 10), rep("sample2", 10)),
  fg_quantity = c(rep(2000, 20)),
  eg_mean_apex_rt = c(rep(c(1, 2, 3, 4, 5, 6, 7, 8, 9, 10), 2)),
  eg_start_rt = c(0.5, 1, 3, 4, 5, 6, 7, 7.5, 8, 9, 1, 2, 2, 3, 4, 5, 5, 8, 9, 9),
  eg_end_rt = c(
    1.5, 2, 3.1, 4.5, 5.8, 6.6, 8, 8, 8.4,
    9.1, 3, 2.2, 4, 3.4, 4.5, 5.5, 5.6, 8.3, 10, 12
  )
)
qc_peak_width(
  data,
  sample = r_file_name,
  intensity = fg_quantity,
  retention_time = eg_mean_apex_rt,
  retention_time_start = eg_start_rt,
  retention_time_end = eg_end_rt
)

Check peptide type percentage share

Description

Calculates the percentage share of each peptide types (fully-tryptic, semi-tryptic, non-tryptic) for each sample.

Usage

qc_peptide_type(
  data,
  sample,
  peptide,
  pep_type,
  intensity,
  remove_na_intensities = TRUE,
  method = "count",
  plot = FALSE,
  interactive = FALSE
)

Arguments

data

a data frame that contains at least the input columns.

sample

a character or factor column in the data data frame that contains the sample names.

peptide

a character column in the data data frame that contains the peptide sequence.

pep_type

a character column in the data data frame that contains the peptide type. Can be obtained using the find_peptide and assign_peptide_type function together.

intensity

a numeric column in the data data frame that contains the corresponding raw or normalised intensity values (not log2) for each peptide or precursor. Required when "intensity" is chosen as the method.

remove_na_intensities

a logical value that specifies if sample/peptide combinations with intensities that are NA (not quantified IDs) should be dropped from the data frame for analysis of peptide type distributions. Default is TRUE since we are usually interested in the peptide type distribution of quantifiable IDs. This is only relevant for method = "count".

method

a character value that indicates the method used for evaluation. method = "intensity" calculates the peptide type percentage by intensity, whereas method = "count" calculates the percentage by peptide ID count. Default is method = count.

plot

a logical value that indicates whether the result should be plotted.

interactive

a logical value that indicates whether the plot should be interactive.

Value

A data frame that contains the calculated percentage shares of each peptide type per sample. The count column contains the number of peptides with a specific type. The peptide_type_percent column contains the percentage share of a specific peptide type.

Examples

# Load libraries
library(dplyr)

set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 100,
  frac_change = 0.05,
  n_replicates = 3,
  n_conditions = 2,
  method = "effect_random"
) %>%
  mutate(intensity_non_log2 = 2^peptide_intensity_missing)

# Determine peptide type percentages
qc_peptide_type(
  data = data,
  sample = sample,
  peptide = peptide,
  pep_type = pep_type,
  intensity = intensity_non_log2,
  method = "intensity",
  plot = FALSE
)

# Plot peptide type
qc_peptide_type(
  data = data,
  sample = sample,
  peptide = peptide,
  pep_type = pep_type,
  intensity = intensity_non_log2,
  method = "intensity",
  plot = TRUE
)

Proteome coverage per sample and total

Description

Calculates the proteome coverage for each samples and for all samples combined. In other words t he fraction of detected proteins to all proteins in the proteome is calculated.

Usage

qc_proteome_coverage(
  data,
  sample,
  protein_id,
  organism_id,
  reviewed = TRUE,
  plot = TRUE,
  interactive = FALSE
)

Arguments

data

a data frame that contains at least sample names and protein ID's.

sample

a character column in the data data frame that contains the sample name.

protein_id

a character or numeric column in the data data frame that contains protein identifiers such as UniProt accessions.

organism_id

a numeric value that specifies a NCBI taxonomy identifier (TaxId) of the organism used. Human: 9606, S. cerevisiae: 559292, E. coli: 83333.

reviewed

a logical value that determines if only reviewed protein entries will be considered as the full proteome. Default is TRUE.

plot

a logical value that specifies whether the result should be plotted.

interactive

a logical value that indicates whether the plot should be interactive (default is FALSE).

Value

A bar plot showing the percentage of of the proteome detected and undetected in total and for each sample. If plot = FALSE a data frame containing the numbers is returned.

Examples


# Create example data
proteome <- data.frame(id = 1:4518)
data <- data.frame(
  sample = c(rep("A", 101), rep("B", 1000), rep("C", 1000)),
  protein_id = c(proteome$id[1:100], proteome$id[1:1000], proteome$id[1000:2000])
)

# Calculate proteome coverage
qc_proteome_coverage(
  data = data,
  sample = sample,
  protein_id = protein_id,
  organism_id = 83333,
  plot = FALSE
)

# Plot proteome coverage
qc_proteome_coverage(
  data = data,
  sample = sample,
  protein_id = protein_id,
  organism_id = 83333,
  plot = TRUE
)


Check ranked intensities

Description

Calculates and plots ranked intensities for proteins, peptides or precursors.

Usage

qc_ranked_intensities(
  data,
  sample,
  grouping,
  intensity_log2,
  facet = FALSE,
  plot = FALSE,
  y_axis_transformation = "log10",
  interactive = FALSE
)

Arguments

data

a data frame that contains at least sample names, grouping identifiers (precursor, peptide or protein) and log2 transformed intensities for each grouping identifier.

sample

a character column in the data data frame that contains the sample names.

grouping

a character column in the data data frame that contains protein, precursor, or peptide identifiers.

intensity_log2

a numeric column in the data data frame that contains the log2 transformed intensities of the selected grouping variable.

facet

a logical value that specifies whether the calculation should be done group wise by sample and if the resulting plot should be faceted by sample. (default is FALSE). If facet = FALSE the median of each protein intensity will be returned.

plot

a logical value that specifies whether the result should be plotted (default is FALSE).

y_axis_transformation

a character value that determines that y-axis transformation. The value is either "log2" or "log10" (default is "log10").

interactive

a logical value that specifies whether the plot should be interactive (default is FALSE).

Value

A data frame containing the ranked intensities is returned. If plot = TRUE a plot is returned. The intensities are log10 transformed for the plot.

Examples

set.seed(123) # Makes example reproducible

# Create synthetic data
data <- create_synthetic_data(
  n_proteins = 50,
  frac_change = 0.05,
  n_replicates = 4,
  n_conditions = 3,
  method = "effect_random",
  additional_metadata = FALSE
)

# Plot ranked intensities for all samples combined
qc_ranked_intensities(
  data = data,
  sample = sample,
  grouping = peptide,
  intensity_log2 = peptide_intensity,
  plot = TRUE,
)

# Plot ranked intensities for each sample separately
qc_ranked_intensities(
  data = data,
  sample = sample,
  grouping = peptide,
  intensity_log2 = peptide_intensity,
  plot = TRUE,
  facet = TRUE
)


Correlation based hirachical clustering of samples

Description

A correlation heatmap is created that uses hirachical clustering to determine sample similarity.

Usage

qc_sample_correlation(
  data,
  sample,
  grouping,
  intensity_log2,
  condition,
  digestion = NULL,
  run_order = NULL,
  method = "spearman",
  interactive = FALSE
)

Arguments

data

a data frame that contains at least the input variables.

sample

a character column in the data data frame that contains the sample names.

grouping

a character column in the data data frame that contains precursor or peptide identifiers.

intensity_log2

a numeric column in the data data frame that contains log2 intensity values.

condition

a character or numeric column in the data data frame that contains the conditions.

digestion

optional, a character column in the data data frame that contains information about the digestion method used. e.g. "LiP" or "tryptic control".

run_order

optional, a character or numeric column in the data data frame that contains the order in which samples were measured. Useful to investigate batch effects due to run order.

method

a character value that specifies the method to be used for correlation. "spearman" is the default but can be changed to "pearson" or "kendall".

interactive

a logical value that specifies whether the plot should be interactive. Determines if an interactive or static heatmap should be created using heatmaply or pheatmap, respectively.

Value

A correlation heatmap that compares each sample. The dendrogram is sorted by optimal leaf ordering.

Examples


set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 100,
  frac_change = 0.05,
  n_replicates = 3,
  n_conditions = 2,
  method = "effect_random"
)

# Create sample correlation heatmap
qc_sample_correlation(
  data = data,
  sample = sample,
  grouping = peptide,
  intensity_log2 = peptide_intensity_missing,
  condition = condition
)


Protein coverage distribution

Description

Plots the distribution of protein coverages in a histogram.

Usage

qc_sequence_coverage(
  data,
  protein_identifier,
  coverage,
  sample = NULL,
  interactive = FALSE
)

Arguments

data

a data frame that contains at least the input variables.

protein_identifier

a character column in the data data frame that contains protein identifiers.

coverage

a numeric column in the data data frame that contains protein coverage in percent. This information can be obtained using the sequence_coverage function.

sample

optional, a character or factor column in the data data frame that contains sample names. Please only provide this argument if you want to facet the distribution plot by sample otherwise do not provide this argument.

interactive

a logical value that specifies whether the plot should be interactive (default is FALSE).

Value

A protein coverage histogram with 5 percent binwidth. The vertical dotted line indicates the median.

See Also

sequence_coverage

Examples

set.seed(123) # Makes example reproducible

# Create example data
data <- create_synthetic_data(
  n_proteins = 100,
  frac_change = 0.05,
  n_replicates = 3,
  n_conditions = 2,
  method = "effect_random"
)

# Plot sequence coverage
qc_sequence_coverage(
  data = data,
  protein_identifier = protein,
  coverage = coverage
)

Randomise samples in MS queue

Description

[Experimental] This function randomises the order of samples in an MS queue. QC and Blank samples are left in place. It is also possible to randomise only parts of the queue. Before running this make sure to set a specific seed with the set.seed() function. This ensures that the randomisation of the result is consistent if the function is run again.

Usage

randomise_queue(data = NULL, rows = NULL, export = FALSE)

Arguments

data

optional, a data frame that contains a queue. If not provided a queue file can be chosen interactively.

rows

optional, a numeric vector that specifies a range of rows in for which samples should be randomized.

export

a logical value that determines if a "randomised_queue.csv" file will be saved in the working directory. If FALSE a data frame will be returned.

Value

If export = TRUE a "randomised_queue.csv" file will be saved in the working directory. If export = FALSE a data frame that contains the randomised queue is returned.

Examples

queue <- create_queue(
  date = c("200722"),
  instrument = c("EX1"),
  user = c("jquast"),
  measurement_type = c("DIA"),
  experiment_name = c("JPQ031"),
  digestion = c("LiP", "tryptic control"),
  treatment_type_1 = c("EDTA", "H2O"),
  treatment_type_2 = c("Zeba", "unfiltered"),
  treatment_dose_1 = c(10, 30, 60),
  treatment_unit_1 = c("min"),
  n_replicates = 4,
  number_runs = FALSE,
  organism = c("E. coli"),
  exclude_combinations = list(list(
    treatment_type_1 = c("H2O"),
    treatment_type_2 = c("Zeba", "unfiltered"),
    treatment_dose_1 = c(10, 30)
  )),
  inj_vol = c(2),
  data_path = "D:\\2007_Data",
  method_path = "C:\\Xcalibur\\methods\\DIA_120min",
  position_row = c("A", "B", "C", "D", "E", "F"),
  position_column = 8,
  blank_every_n = 4,
  blank_position = "1-V1",
  blank_method_path = "C:\\Xcalibur\\methods\\blank"
)

head(queue, n = 20)

randomised_queue <- randomise_queue(
  data = queue,
  export = FALSE
)

head(randomised_queue, n = 20)

Rapamycin 10 uM example data

Description

Rapamycin example data used for the vignette about binary control/treated data. The data was obtained from Piazza 2020 and corresponds to experiment 18. FKBP1A the rapamycin binding protein and 49 other randomly sampled proteins were used for this example dataset. Furthermore, only the DMSO control and the 10 uM condition were used.

Usage

rapamycin_10uM

Format

A data frame containing peptide level data from a Spectronaut report.

Source

Piazza, I., Beaton, N., Bruderer, R. et al. A machine learning-based chemoproteomic approach to identify drug targets and binding sites in complex proteomes. Nat Commun 11, 4200 (2020). doi:10.1038/s41467-020-18071-x


Rapamycin dose response example data

Description

Rapamycin example data used for the vignette about dose response data. The data was obtained from Piazza 2020 and corresponds to experiment 18. FKBP1A the rapamycin binding protein and 39 other randomly sampled proteins were used for this example dataset. The concentration range includes the following points: 0 (DMSO control), 10 pM, 100 pM, 1 nM, 10 nM, 100 nM, 1 uM, 10 uM and 100 uM.

Usage

rapamycin_dose_response

Format

A data frame containing peptide level data from a Spectronaut report.

Source

Piazza, I., Beaton, N., Bruderer, R. et al. A machine learning-based chemoproteomic approach to identify drug targets and binding sites in complex proteomes. Nat Commun 11, 4200 (2020). doi:10.1038/s41467-020-18071-x


Read, clean and convert

Description

The function uses the very fast fread function form the data.table package. The column names of the resulting data table are made more r-friendly using clean_names from the janitor package. It replaces "." and " " with "_" and converts names to lower case which is also known as snake_case. In the end the data table is converted to a tibble.

Usage

read_protti(filename, ...)

Arguments

filename

a character value that specifies the path to the file.

...

additional arguments for the fread function.

Value

A data frame (with class tibble) that contains the content of the specified file.

Examples

## Not run: 
read_protti("folder\\filename")

## End(Not run)

Replace identified positions in protein sequence by "x"

Description

Helper function for the calculation of sequence coverage, replaces identified positions with an "x" within the protein sequence.

Usage

replace_identified_by_x(sequence, positions_start, positions_end)

Arguments

sequence

a character value that contains the protein sequence.

positions_start

a numeric vector of start positions of the identified peptides.

positions_end

a numeric vector of end positions of the identified peptides.

Value

A character vector that contains the modified protein sequence with each identified position replaced by "x".


Scaling a vector

Description

scale_protti is used to scale a numeric vector either between 0 and 1 or around a centered value using the standard deviation. If a vector containing only one value or repeatedly the same value is provided, 1 is returned as the scaled value for method = "01" and 0 is returned for metod = "center".

Usage

scale_protti(x, method, default_to_high = TRUE)

Arguments

x

a numeric vector

method

a character value that specifies the method to be used for scaling. "01" scales the vector between 0 and 1. "center" scales the vector equal to base::scale around a center. This is done by subtracting the mean from every value and then deviding them by the standard deviation.

default_to_high

if there is only one number in the vector the "01" method will default to scale this to 1. If this argument is set to FALSE it will be scaled to 0 instead.

Value

A scaled numeric vector.

Examples

scale_protti(c(1, 2, 1, 4, 6, 8), method = "01")

Protein sequence coverage

Description

[Deprecated] This function was deprecated due to its name changing to calculate_sequence_coverage().

Usage

sequence_coverage(...)

Value

A new column in the data data frame containing the calculated sequence coverage for each identified protein


Convert metal names to search pattern

Description

Converts a vector of metal names extracted from the ft_metal column obtained with fetch_uniprot to a pattern that can be used to search for corresponding ChEBI IDs. This is used as a helper function for other functions.

Usage

split_metal_name(metal_names)

Arguments

metal_names

a character vector containing names of metals and metal containing molecules.

Value

A character vector with metal name search patterns.


Check treatment enrichment

Description

[Deprecated] This function was deprecated due to its name changing to calculate_treatment_enrichment().

Usage

treatment_enrichment(...)

Value

A bar plot displaying the percentage of all detect proteins and all significant proteins that bind to the treatment. A Fisher's exact test is performed to calculate the significance of the enrichment in significant proteins compared to all proteins. The result is reported as a p-value. If plot = FALSE a contingency table in long format is returned.


Query from URL

Description

Downloads data table from URL. If an error occurs during the query (for example due to no connection) the function waits 3 seconds and tries again. If no result could be obtained after the given number of tries a message indicating the problem is returned.

Usage

try_query(
  url,
  max_tries = 5,
  silent = TRUE,
  type = "text/tab-separated-values",
  timeout = 60,
  accept = NULL,
  ...
)

Arguments

url

a character value of an URL to the website that contains the table that should be downloaded.

max_tries

a numeric value that specifies the number of times the function tries to download the data in case an error occurs. Default is 5.

silent

a logical value that specifies if individual messages are printed after each try that failed.

type

a character value that specifies the type of data at the target URL. Options are all options that can be supplied to httr::content, these include e.g. "text/tab-separated-values", "application/json" and "txt/csv". Default is "text/tab-separated-values".

timeout

a numeric value that specifies the maximum request time. Default is 60 seconds.

accept

a character value that specifies the type of data that should be sent by the API if it uses content negotiation. The default is NULL and it should only be set for APIs that use content negotiation.

...

other parameters supplied to the parsing function used by httr::content.

Value

A data frame that contains the table from the url.


Perform Welch's t-test

Description

Performs a Welch's t-test and calculates p-values between two groups.

Usage

ttest_protti(mean1, mean2, sd1, sd2, n1, n2, log_values = TRUE)

Arguments

mean1

a numeric vector that contains the means of group1.

mean2

a numeric vector that contains the means of group2.

sd1

a numeric vector that contains the standard deviations of group1.

sd2

a numeric vector that contains the standard deviations of group2.

n1

a numeric vector that contains the number of replicates used for the calculation of each mean and standard deviation of group1.

n2

a numeric vector that contains the number of replicates used for the calculation of each mean and standard deviation of group2.

log_values

a logical value that indicates if values are log transformed. This determines how fold changes are calculated. Default is log_values = TRUE.

Value

A data frame that contains the calculated differences of means, standard error, t statistic and p-values.

Examples

ttest_protti(
  mean1 = 10,
  mean2 = 15.5,
  sd1 = 1,
  sd2 = 0.5,
  n1 = 3,
  n2 = 3
)

Viridis colour scheme

Description

A colour scheme by the viridis colour scheme from the viridis R package.

Usage

viridis_colours

Format

A vector containing 256 colours

Source

viridis R package, created by Stéfan van der Walt (stefanv) and Nathaniel Smith (njsmith)


Volcano plot

Description

Plots a volcano plot for the given input.

Usage

volcano_plot(
  data,
  grouping,
  log2FC,
  significance,
  method,
  target_column = NULL,
  target = NULL,
  facet_by = NULL,
  facet_scales = "fixed",
  title = "Volcano plot",
  x_axis_label = "log2(fold change)",
  y_axis_label = "-log10(p-value)",
  legend_label = "Target",
  colour = NULL,
  log2FC_cutoff = 1,
  significance_cutoff = 0.01,
  interactive = FALSE
)

Arguments

data

a data frame that contains at least the input variables.

grouping

a character column in the data data frame that contains either precursor or peptide identifiers.

log2FC

a character column in the data data frame that contains the log2 transfromed fold changes between two conditions.

significance

a character column in the data data frame that contains the p-value or adjusted p-value for the corresponding fold changes. The values in this column will be transformed using the -log10 and displayed on the y-axis of the plot.

method

a character value that specifies the method used for the plot. method = "target" highlights your protein, proteins or any other entities of interest (specified in the target argument) in the volcano plot. method = "significant" highlights all significantly changing entities.

target_column

optional, a column required for method = "target", can contain for example protein identifiers or a logical that marks certain proteins such as proteins that are known to interact with the treatment. Can also be provided if method = "significant" to label data points in an interactive plot.

target

optional, a vector required for method = "target". It can contain one or more specific entities of the column provided in target_column. This can be for example a protein ID if target_column contains protein IDs or TRUE or FALSE for a logical column.

facet_by

optional, a character column that contains information by which the data should be faceted into multiple plots.

facet_scales

a character value that specifies if the scales should be "free", "fixed", "free_x" or "free_y", if a faceted plot is created. These inputs are directly supplied to the scales argument of ggplot2::facet_wrap().

title

optional, a character value that specifies the title of the volcano plot. Default is "Volcano plot".

x_axis_label

optional, a character value that specifies the x-axis label. Default is "log2(fold change)".

y_axis_label

optional, a character value that specifies the y-axis label. Default is "-log10(q-value)".

legend_label

optional, a character value that specifies the legend label. Default is "Target".

colour

optional, a character vector containing colours that should be used to colour points according to the selected method. IMPORTANT: the first value in the vector is the default point colour, the additional values specify colouring of target or significant points. E.g. c("grey60", "#5680C1") to achieve the same colouring as the default for the "significant" method.

log2FC_cutoff

optional, a numeric value that specifies the log2 transformed fold change cutoff used for the vertical lines, which can be used to assess the significance of changes. Default value is 1.

significance_cutoff

optional, a character vector that specifies the p-value cutoff used for the horizontal cutoff line, which can be used to assess the significance of changes. The vector can consist solely of one element, which is the cutoff value. In that case the cutoff will be applied directly to the plot. Alternatively, a second element can be provided to the vector that specifies a column in the data data frame which contains e.g. adjusted p-values. In that case the y-axis of the plot could display p-values that are provided to the significance argument, while the horizontal cutoff line is on the scale of adjusted p-values transformed to the scale of p-values. The provided vector can be e.g. c(0.05, "adj_pval"). In that case the function looks for the closest adjusted p-value above and below 0.05 and takes the mean of the corresponding p-values as the cutoff line. If there is no adjusted p-value in the data that is below 0.05 no line is displayed. This allows the user to display volcano plots using p-values while using adjusted p-values for the cutoff criteria. This is often preferred because adjusted p-values are related to unadjusted p-values often in a complex way that makes them hard to be interpret when plotted. Default is c(0.01).

interactive

a logical value that specifies whether the plot should be interactive (default is FALSE).

Value

Depending on the method used a volcano plot with either highlighted targets (method = "target") or highlighted significant proteins (method = "significant") is returned.

Examples

set.seed(123) # Makes example reproducible

# Create synthetic data
data <- create_synthetic_data(
  n_proteins = 10,
  frac_change = 0.5,
  n_replicates = 4,
  n_conditions = 3,
  method = "effect_random",
  additional_metadata = FALSE
)

# Assign missingness information
data_missing <- assign_missingness(
  data,
  sample = sample,
  condition = condition,
  grouping = peptide,
  intensity = peptide_intensity_missing,
  ref_condition = "all",
  retain_columns = c(protein, change_peptide)
)

# Calculate differential abundances
diff <- calculate_diff_abundance(
  data = data_missing,
  sample = sample,
  condition = condition,
  grouping = peptide,
  intensity_log2 = peptide_intensity_missing,
  missingness = missingness,
  comparison = comparison,
  method = "t-test",
  retain_columns = c(protein, change_peptide)
)

volcano_plot(
  data = diff,
  grouping = peptide,
  log2FC = diff,
  significance = pval,
  method = "target",
  target_column = change_peptide,
  target = TRUE,
  facet_by = comparison,
  significance_cutoff = c(0.05, "adj_pval")
)

Volcano plot

Description

[Deprecated] This function was deprecated due to its name changing to volcano_plot().

Usage

volcano_protti(...)

Value

Depending on the method used a volcano plot with either highlighted targets (method = "target") or highlighted significant proteins (method = "significant") is returned.


Woods' plot

Description

Creates a Woods' plot that plots log2 fold change of peptides or precursors along the protein sequence. The peptides or precursors are located on the x-axis based on their start and end positions. The position on the y-axis displays the fold change. The vertical size (y-axis) of the box representing the peptides or precursors do not have any meaning.

Usage

woods_plot(
  data,
  fold_change,
  start_position,
  end_position,
  protein_length,
  coverage = NULL,
  protein_id,
  targets = "all",
  facet = TRUE,
  colouring = NULL,
  fold_change_cutoff = 1,
  highlight = NULL,
  export = FALSE,
  export_name = "woods_plots"
)

Arguments

data

a data frame that contains differential abundance, start and end peptide or precursor positions, protein length and optionally a variable based on which peptides or precursors should be coloured.

fold_change

a numeric column in the data data frame that contains log2 fold changes.

start_position

a numeric column in the data data frame that contains the start positions for each peptide or precursor.

end_position

a numeric column in the data data frame that contains the end positions for each peptide or precursor.

protein_length

a numeric column in the data data frame that contains the length of the protein.

coverage

optional, a numeric column in the data data frame that contains coverage in percent. Will appear in the title of the Woods' plot if provided.

protein_id

a character column in the data data frame that contains protein identifiers.

targets

a character vector that specifies the identifiers of the proteins (depending on protein_id) that should be plotted. This can also be "all" if plots for all proteins should be created. Default is "all".

facet

a logical value that indicates if plots should be summarised into facets of 20 plots. This is recommended for many plots. Default is facet = TRUE.

colouring

optional, a character or numeric (discrete or continous) column in the data frame containing information by which peptide or precursors should be coloured.

fold_change_cutoff

optional, a numeric value that specifies the log2 fold change cutoff used in the plot. The default value is 2.

highlight

optional, a logical column that specifies whether specific peptides or precursors should be highlighted with an asterisk.

export

a logical value that indicates if plots should be exported as PDF. The output directory will be the current working directory. The name of the file can be chosen using the export_name argument. Default is export = FALSE.

export_name

a character vector that provides the name of the exported file if export = TRUE. Default is export_name = "woods_plots"

Value

A list containing Woods' plots is returned. Plotting peptide or precursor log2 fold changes along the protein sequence.

Examples

# Create example data
data <- data.frame(
  fold_change = c(2.3, 0.3, -0.4, -4, 1),
  pval = c(0.001, 0.7, 0.9, 0.003, 0.03),
  start = c(20, 30, 45, 90, 140),
  end = c(33, 40, 64, 100, 145),
  protein_length = c(rep(150, 5)),
  protein_id = c(rep("P1", 5))
)

# Plot Woods' plot
woods_plot(
  data = data,
  fold_change = fold_change,
  start_position = start,
  end_position = end,
  protein_length = protein_length,
  protein_id = protein_id,
  colouring = pval
)

These binaries (installable software) and packages are in development.
They may not be fully stable and should be used with caution. We make no claims about them.